Báo cáo hóa học: " Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent" docx
Báo cáo hóa học: " Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent" docx
... 9:8http://www.translational-medicine.com/content/9/1/8Page 7 of 12RESEARCH Open Access Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agentTomohisa Horibe, Masayuki Kohno, Mari Haramoto, ... carboxytetramethyl rhodamine(TAMRA)-labeled Antp -TPR (Antp -TPR- TAMRA) or TPR (TPR- TAMRA) as indicated. Cells were then analyzed by phase-contrast (DIC), fluorescence(TAMRA-red) or merge image ... article as: Horibe et al.: Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent. Journal of Translational Medicine 20119:8.Submit your next manuscript to BioMed Centraland...
- 12
- 309
- 0
báo cáo hóa học: " Methyl salicylate 2-O-b-D-lactoside, a novel salicylic acid analogue, acts as an antiinflammatory agent on microglia and astrocytes" docx
... C, Mollica A, Iannitelli DAE,Cataldi A, Zara S, Nasuti C, Di Stefano A: Ibuprofen and GlutathioneConjugate as a Potential Therapeutic Agent for Treating Alzheimer’sDisease. Arch Pharm (Weinheim) ... expression.Neuroinflammation, represented by activated microgliaand astrocytes, is a prominent pathological feature thatcontributestoneurodegenerationinAD.InADbrain,activated microglia release a variety ... COX-1 activity alone.At least thr ee independent experiments were used fordata analysis. All data are presented as mean ± S.E.M.Values were compared using a t-test (two groups) orone-way ANOVA...
- 7
- 409
- 0
báo cáo hóa học: " Patterns of pulmonary dysfunction in asbestos workers: a cross-sectional study" docx
... washout vol-ume was 1 L and for those with FVC of less than 2 L, thewashout volume was 0.5 L. A pulmonary gas analyzer(GC-1, Shanghai, China) was used for gas analysis. DLCOwas calculated using ... not have radiographic asbes-tosis or emphysema (Table 5). As expected, pack-years ofsmoking was significantly associated with FEV1 andFEV1/FVC ratio. Similarly, the pack-years variable wassignificantly ... used as surrogate measure of total asbestos exposure.Clinical EvaluationUsing a Chinese standardized respiratory questionnaire,which was based on Medical Research Council Question-naire [37],...
- 7
- 334
- 0
Báo cáo hóa học: " Discovery of frameshifting in Alphavirus 6K resolves a 20-year enigma" docx
... overscores.CGGGCGCACGCAGCUAGUGUGGCAGAGACU A UGGCCUACUUGUGGGACCAAAACCAAGCGUUGUUCUGGUUGGAGUUUGCGGCCCCUGUUGCCUGCAUCCUCAUCAUCACGU A UUGCCUCAGAAACGUGCUGUGUUGCUGUAAGAGCCUUUCUUUUUUAGUGCUACUGAGCCUCGGGGCAACCGCCAGAGCUUACGAACAUUCGACAGUAAUGCCGAACGUGGUGGGGUUCCCGU A UAAGRAHAASVAETMAYLWDQNQALFWLEFAAPVACI ... 41TF(GCCTTTCTTTTTTAGTGCTACTTAGCCTCGGGGC) and41TR (GCCCCGAGGCTAAGTAGCACTAAAAAAGAAAGGC). PCR product was then transformed into DH5αT1cells (InVitrogen) and plated on Ampicillin-LB plates.Propagated plasmids ... efficiency (dual luciferase assays with inserts comprising the U UUU UUA motif and 3'-adjacent sequence; B Chung et al, in preparation). Base variations that maintain base-pairings are marked in...
- 19
- 466
- 0
báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot
... was decreased [18], which was also su pported bythe FA-PEAs:pVHL polyplexes.Similarly, the transfection efficiency of FA-PEAs andHPEI was increased and the cytotoxicity w as decreasedcompared ... PEI:pVHLcomplexes was larger than the FA-PEAs:pVHL com-plexes obviously at same ratio. Generally, the particlesize of FA-PEAs:pVHL complexes was decreased alongwith the increase of the weight ratios between ... cytotoxicity was acceptable, thecomplexes were kept stable. In addition, the averagezeta potential of FA-PEAs:pVHL complexes at 10:1 ~30:1 mass ratio, was in the range of 7.1 to 31.6 mV,which was a little...
- 10
- 306
- 0
báo cáo hóa học:" The validity of self-rated health as a measure of health status among young military personnel: evidence from a cross-sectional survey" pot
... Dis-charge was assessed both after BMT and after technicaltraining school, the second level training after BMT, andbefore a participant's permanent duty assignment.Approach to statistical analysesIn ... Thespontaneous assessment perspective posits that ratings ofoverall self rated health are developed based on health sta-tus at any given point in time and fluctuates as health sta-tus changes. Alternatively, ... status were related to higherhealth needs after military deployment. Additional dataare needed so that military leaders can appropriately usedata regarding a military member's assessment...
- 9
- 301
- 0
Báo cáo hóa học: " Effects of pentacene-doped PEDOT:PSS as a holeconducting layer on the performance characteristics of polymer photovoltaic cells" pot
... donor was pur-chased from Rieke Metal Inc. (Lincoln, NE, USA). PCBM as an electron acceptor was purchased from N ano-C(Westwood, MA, USA). Aluminum as a cathode was pur-chased from CERAC™, Inc. ... devices that the measured hole mobility increases alongwith the increase of the annealing temperature, startingto increas e at a low temperature and saturating at a hightemperature. The pentacene-doped ... was increased, UV-visible transmittance also increased dramatically. By increasing the amountof pentacene in PEDOT:PSS films, dramatic decreases in both the work function and surface resistance...
- 8
- 401
- 0
báo cáo hóa học: "Fibrillar beta-amyloid peptide Aβ1–40 activates microglial proliferation via stimulating TNF-α release and H2O2 derived from NADPH oxidase: a cell culture study" doc
... when activated by β-amyloid, bacteriaand/or cytokines, the oxidase assembles at the plasmamembrane, and produces superoxide that is releasedextracellularly or into phagosomes at a high rate. ... increase TNF-α levels, to a degreesimilar to that caused by fibrillar A , and this PMA-induced increase was blocked by apocynin and catalase(Fig. 7).The effect of TNF-α neutralisation on A β1–40-induced ... by apocynin and catalase. This suggests thatactivation of NADPH oxidase is sufficient to inducemicroglial proliferation via H2O2 production, and thatactivation of the oxidase by fibrillar...
- 13
- 388
- 0
báo cáo hóa học:" Lentivirus-mediated RNAi silencing targeting ABCC2 increasing the sensitivity of a human nasopharyngeal carcinoma cell line against cisplatin" docx
... ABCC2-dependingcisplatin resistance in NPC.ABCC2 siRNA increased the intracellular accumulation of cisplatinFigure 2ABCC2 siRNA increased the intracellular accumulation of cisplatin. (A) A typical chromatogram ... 5'-CACCCAGCACAATGAAGAT-3'; ACTBreverse: 5'-CA AATAAAGCCATGCCAAT-3'. Cycling condi-tions were used as described previously [17]: 95°C for 10min to activate DNA polymerase, followed ... genes designed by Primer premier 5.0 software were as follow:ABCC2 forward: 5'-CTC ACTTCAGCGAGACCG-3';ABCC2 reverse: 5'-CCAGCCAGTTCAGGGTTT-3'; ACTBforward: 5'-CACCCAGCACAATGAAGAT-3';...
- 9
- 509
- 0
báo cáo hóa học:" Optical imaging of the peri-tumoral inflammatory response in breast cancer" docx
... breast can-cer is a well characterized model which recapitulateshuman disease, with progression from hyperplasia toinvasive carcinoma and metastatic disease at ~115 days oflife [3,18]. As ... individuals, such as organ trans-plant recipients, have a lower incidence of breast cancer[1,2]. It has also been noted that as breast cancerprogresses, there is a corresponding increase in thenumber ... and metastasis. Nat Rev Cancer 2004, 4:71-78.19. Jiang H, Iftimia NV, Xu Y, Eggert JA, Fajardo LL, Klove KL: Near-infrared optical imaging of the breast with model-basedreconstruction. Acad...
- 9
- 742
- 0
Từ khóa: báo cáo môn học hóa dầubáo cáo trường học văn hóa năm 2012báo cáo trường học văn hóaquảng cáo trên báo giấy hoa học tròbáo cáo khoa họcbáo cáo y họcNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXchuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM