ambient intelligence a novel paradigm
... L.Scozzafava 1 1 Dipartiment o di Informatica e Sistemistica, University of Rome, La Sapienza, Italy {bahadori, iocchi, leone, nardi, scozzafava}@dis.uniroma1.it Planning and Scheduling Team, Italian ... computational artifacts is a physically portable computational artifact. Typically these take the form of wearable technology that can monitor and control the iDorm wirelessly. The handhel...
Ngày tải lên: 01/06/2014, 07:47
... percent change in facet-related pain as measured by Visual Analog Scale (VAS) score at final follow-up visit. Secondary outcome was change in OSWESTRY disability index from preoperative evaluation ... nerve branch, with durable results. Large scale, randomized trials are warranted to further evaluate the relative efficacy of this surgical treatment in patients with facet joint disease....
Ngày tải lên: 26/10/2012, 09:32
... AAGGAGGCACTGGGAGAGGGGAAAT -3’ (bases -1323 to -1299 from the major transcriptional initiation site) and antisense, 5’-AATTAGCTGGGCATGGTGGCAGGCG-3’ (bases -1075 to -1051)) that recognize part ... 5’-AAGGAGGCACTGGGAGAGGGGAAAT-3’ (bases -1323 to -1299) and antisense, 5’- CCCCACCAAGCCAACACAGGATGGA -3’ (bases -919 to-895) were used to amplify a 429-bp product from genomic DNA (Fig. 1A)...
Ngày tải lên: 26/10/2012, 10:04
Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"
... Zhao Z, Lange DJ, Voustianiouk A, Macgrogan D, Ho L, Suh J, Humala N, Thiyagarajan M, Wang J, Pasinetti GM. A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral ... incubation with a reporter antibody (HRP–conjugated anti–rabbit IgG, Santa Cruz Biotech, CA). The assay was developed using a stabilized HRP substrate. All samples were analyzed in...
Ngày tải lên: 03/11/2012, 10:52
Domestic Wastewater Reclamation Coupled with Biofuel/Biomass Production Based on Microalgae: A Novel Wastewater Treatment Process in the Future
... reclamation coupled with biofuel/biomass production based on microalgae is proposed in this paper. The organic pollutants in wastewater are separated and concentrated by flocculation and filtration, ... cultivation and reclamation Artificial wetland Disinfection Environmental and landscape reuse Municipal reuse Industrial reuse Carbon Capture and Storage (CCS) CO 2 Wetland plants Primary...
Ngày tải lên: 05/09/2013, 10:17
Research on a novel buck boost converter for wind turbine systems
... (4) In practical implementation of an inverter control, a sinusoidal reference wave, serving as the modulating signal, is compared with a triangular wave, serving as the carrier signal. The ... the negative half cycle and the discharging current has an opposite direction. Then similar arguments regarding energy exchange and transfer in Mode 2 can be also applied to Mode 3. As a r...
Ngày tải lên: 03/01/2014, 19:16
A novel interval method for validating state enclosures of the
... article, 2 the words validated, guaranteed, and verified are used interchangeably to denote that state enclosures are mathematically and not only empirically proven to be correct. Traditional validated techniques ... numerical simulations have to be performed in almost all practical applications due to the lack of analytical solutions. If usual floating point techniques with inappropriate step-...
Ngày tải lên: 12/01/2014, 22:04
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx
... molecular basis of enzyme thermosta- bility. J Bacteriol 185, 4038–4049. 20 Nanba H, Yajima K, Takano M, Yamada Y, Ikenaka Y & Takahashi S (1997) Process for producing d-N-car- bamoyl -a- amino acid. ... DNA sequences flanking the Jannaschia sp. CCS1 HYD Js revealed an ORF encoding a putative allantoate amido- hydrolase, which is part of the urate catabolic pathway in many organisms [8]....
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf
... AGCTGATCTTCGAAGATCTTCGAAGAT Mutated HSE sense Biotin-TCGACTT CAAGCTTGTACAAGCTTGTAG Mutated HSE antisense AGCTGAAGTTCGAACATGTTCGAACATC ‘Scrambled’ oligonucleotide Biotin-AACGACGGTCGCTCCGCCTGGCT 140 40 60 80 100 120 Counts ... TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses Kristiina A. Vuori 1 , Johanna K. Ahlskog 2 , Lea Sistonen 2 and...
Ngày tải lên: 18/02/2014, 14:20