Báo cáo khoa học: "THE LEXICAL EXPRESSIONS SEMANTICS OF COMPARATIVE IN A MULTI-LEVEL SEMANTIC PROCESSOR" ppt
... discussed in any detail. Rayner and Banks (1988) describe a logic programming approach to obtaining a parse and an initial logical formula for sentences containing a fairly broad range of CEs. ... re- quire a slightly different approach. Since we are dealing with a mass aggregation rather than a set, the *CARDINALITY* mapping is inapplicable. To measure the size of...
Ngày tải lên: 31/03/2014, 18:20
... complex domains are a 2~al gTz, des domain, giving course grades for students in an academic department, and a bu~di~tg ~rgsvtizatiovt domain, containing information on the floors, wings, corridors, ... in ACQUIRING VERBS FOR STUDENT: A STUDENT CAN pass a course fail a course take a course from an instructor make a grade from an instructor make a grade in a c...
Ngày tải lên: 17/03/2014, 19:21
... functions. As yet, no adequate system for natural language processing has approached human levels of performance. Of the various problems that natural language processing has re- vealed, polysemy ... co-occurrence statistics to create a semantic hyperspace where each word, regardless of its pol- ysemy, is represented as a single vector. Each approach has strengths and limitat...
Ngày tải lên: 20/02/2014, 18:20
Tài liệu Báo cáo khoa học: The tandemly repeated domains of a b-propeller phytase act synergistically to increase catalytic efficiency doc
... InsP 6 gradually into InsP 5 , InsP 4 , and the final product – Ins(2,4,6)P 3 and Ins(1,3,5)P 3 – via two alternative pathways [14]. Bacterial BPPs containing two tandemly repeated domains (dual domains) ... can increase the amount of available phosphate by interacting together. Additionally, fusing PhyH-DI to a single-domain phytase appears to be an efficient way to improve the activity o...
Ngày tải lên: 14/02/2014, 15:20
Tài liệu Báo cáo khoa học: Suppressed catalytic efficiency of plasmin in the presence of long-chain fatty acids Identification of kinetic parameters from continuous enzymatic assay with Monte Carlo simulation ppt
... the amidolytic activity of two truncated plasmin variants was examined (Fig. 8). Miniplasmin (des-kringle 1-4 plasmin) con- tains the kringle 5 and the catalytic domain of plas- min, whereas microplasmin ... numbers, and the absorbance at 405 nm was measured. The mean and standard deviation (dotted lines) of five measurements are shown for both panels. A. Tanka-Salamon et al. Fatty acid...
Ngày tải lên: 18/02/2014, 17:20
Tài liệu Báo cáo khoa học: The thioredoxin-independent isoform of chloroplastic glyceraldehyde-3-phosphate dehydrogenase is selectively regulated by glutathionylation docx
... and purification of Arabidopsis A 4 -GAPDH The sequence encoding the putative mature form of the A. thaliana plastidial A 4 -GAPDH isoform (GapA-1 cDNA At3g26650 provided by TAIR, Stanford, CA, ... & Branlant G (1998) Comparative study of the catalytic domain of phosphorylating glyceraldehyde-3-phosphate dehydro- genases from bacteria and archaea via essential cysteine probe...
Ngày tải lên: 19/02/2014, 05:20
Tài liệu Báo cáo khóa học: The C-terminal domain of Escherichia coli Hfq increases the stability of the hexamer ppt
... protease. This cleavage generates an 83 amino acid fragment containing the N-terminal domain conserved in bacterial Hfqs (% 65 amino acids in Hfq Ec ) and a short part of the C-terminal domain which is ... Figure 4A shows that the native form of Hfq has an apparent molecular mass of 50 ± 10 kDa, while the unfolded state of Hfq has an average apparent molecular mass of 12 ± 5...
Ngày tải lên: 19/02/2014, 12:20
Tài liệu Báo cáo khoa học: Mg2+-modulated KMnO4 reactivity of thymines in the open transcription complex reflects variation in the negative electrostatic potential along the separated DNA strands ppt
... volume integration and area integration of quadrilateral contours encompassing these bands, respectively. For area integration, the lowest intensity point in the graph was used as the horizontal baseline ... the calculation of the contribution of individual bases to the integrated intensity of overlapping DNA bands. Determination of the promoter occupancy Products of the Klenow...
Ngày tải lên: 19/02/2014, 18:20
Tài liệu Báo cáo khoa học: "The grapho-phonological system of written French: Statistical analysis and empirical validation" pdf
... tested in a immediate naming and a delayed naming task with the same stimuli. In the immediate naming condition, participants were instructed to read aloud pseudowords as quickly and as accurately ... list included 32 pairs of pseudowords with contrasting average values of entropy and close values of average grapheme frequency. In addition, stimuli in a matched pair...
Ngày tải lên: 20/02/2014, 19:20
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... comprise Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... and 4) high molecular mass bands of approximately 110 kDa and > 200 kDa were visible, as well as...
Ngày tải lên: 21/02/2014, 00:20