Báo cáo Y học: Histidine mutagenesis of Arabidopsis thaliana pyruvate dehydrogenase kinase ppt

... randalld@missouri.edu Abbreviations: AtPDK, Arabidopsis thaliana pyruvate dehydrogenase kinase; BCKDK, branched-chain a-ketoacid dehydrogenase kinase; E1, pyruvate dehydrogenase; kd-PDC, kinase- depleted pyruvate dehydrogenase ... LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLG...

Ngày tải lên: 31/03/2014, 15:20

... approximately 56% of all ORF A B C Fig. 4. Screen of an Arabidopsis RNA hybrid library to identify RNA bound by APUM-2. (A) Scheme of the three-hybrid strategy used in the screen. (B) Number of colonies ... 5467 Construction of the Arabidopsis RNA hybrid library for the yeast three-hybrid screen The Arabidopsis hybrid RNA library was constructed from total RNA isolated from wi...

Ngày tải lên: 18/02/2014, 06:20

... REVIEW ARTICLE Dynamic mechanism of nick recognition by DNA ligase Alexei V. Cherepanov* and Simon de Vries Kluyver Department of Biotechnology, Delft University of Technology, Delft, the Netherlands DNA ... n-MgAMP-dsDNA, nicked dsDNA adenylylated at the 5¢-phosphate of the nick. Correspondence to S. de Vries, Kluyver Department of Biotechnology, Delft University of Technology, J...

Ngày tải lên: 21/02/2014, 01:21

... 6-P 2 ase activity. The smaller L -form of the enzyme (native M r 132 000) consisted of a variable group of catalytically active polypeptides with M r of 44 000– 70 000. Despite the presence of protease ... of isoforms of the bifunctional enzyme from plants [11,12,14], suggesting that such proteolysis may be a widespread problem. The sensitivity of the plant bifunctional enzym...

Ngày tải lên: 22/02/2014, 04:20

... Resource Center, University of Illinois at Chicago). The peptide was modified by the Correspondence to M. Caffrey, Department of Biochemistry and Molecular Biology, University of Illinois at Chicago, ... Solution structure of the HIV gp120 C5 Domain Laure Guilhaudis, Amy Jacobs and Michael Caffrey Department of Biochemistry and Molecular Biology, University of Illinois at Chicago, I...

Ngày tải lên: 08/03/2014, 16:20

... We Thank Prof B. Bhattacharyya, Bose Institute, Kolkata and Prof U. Chowdhury, University of Calcutta for their suggestions and various helps. We also thank Dr B. Sanyal, Department of Physics, Uppsala ... trials of pig kidney 3,4 dihydroxy phenyl alanine decarboxylase. Biochem. J. 295, 493– 500. 10. Uversky, V.N. & Ptitsyn, O.B. (1994) ‘‘Partly folded state’’, a new equilibrium sta...

Ngày tải lên: 08/03/2014, 23:20

... M., Meyer, T.F. & Gray-Owen, S.D. (2000) Carcinoembryonic antigen family receptor specificity of Neisseria meningitidis Opa variants influences adherence to and invasion of proinflammatory cyto- kine-activated ... described by Davies et al. [22]. The expression of wild-type OpaJ129 was determined by Western blotting using monoclonal antibody 15-1-P5.5 [18]. The expression of wild-typ...

Ngày tải lên: 17/03/2014, 10:20

... .D. (2001 ) Biosynthesis of the linkage region of glycosaminoglycans: c loning and activity of galactosyltransferase II, the sixth member of the b1,3galactosyltransferase f amily (b3GalT6). J. ... and Thierry Hennet Institute of Physiology, University of Zu È rich, Switzerland The b1,3-glycosyltransferase enzymes identi®ed to date share several conserved r egions and c onserved c...

Ngày tải lên: 08/03/2014, 16:20

... paired membranes If analysis of crystalline arrays of paired membranes was focussed on the superposition of both layers, it became clear that the interaction of the rows of PSII complexes of adjacent layers was ... the crystal analysis that the M-type trimers bind more strongly to PSII core complexes in Arabidopsis than in spinach. Keywords: photosystem II; Arabidopsis thalia...

Ngày tải lên: 24/03/2014, 04:21

... thermal stability of the mutated enzymes was poorer than that of thewild-typeenzyme.Theresultsarediscussedintermsof increased molecular ¯exibility of the mutant enzymes at low temperatures. Keywords: xylose ... simultaneously appearing low stability and increased catalytic ef®ciency, proposed to be a consequence of high molecular ¯exibility. T he origin o f the increased enzyme activi...

Ngày tải lên: 31/03/2014, 15:20