Báo cáo khoa học: Cloning of a rat gene encoding the histo-blood group A enzyme Tissue expression of the gene and of the A and B antigens potx
Báo cáo khoa học: Cloning of a rat gene encoding the histo-blood group A enzyme Tissue expression of the gene and of the A and B antigens potx
... Cloning < /b> of < /b> a < /b> rat < /b> gene < /b> encoding < /b> the < /b> histo-blood < /b> group < /b> A < /b> enzyme< /b> Tissue < /b> expression < /b> of < /b> the < /b> gene < /b> and < /b> of < /b> the < /b> A < /b> and < /b> B antigens Anne Cailleau-Thomas1,Be´atrice Le Moullac-Vaidye1,Je´zabel ... transferase) activity of < /b> the < /b> enzyme < /b> product and < /b> alloweddetection of < /b> a < /b> small UDP-Gal:Fuca1,2GalaGal transferase (B transferase) activity. The < /b> presence of < /b> the < /b> mRNA and < /b> of< /b> the < /b> A < /b> and < /b> B antigens was searched ... various BDIX rat< /b> tissues. There was a < /b> general good concordance between the< /b> presence of < /b> the < /b> mRNA and < /b> that of < /b> the < /b> A < /b> antigen. Tissue< /b> distributions of < /b> the < /b> A < /b> and < /b> B antigens in the < /b> homozygousBDIX rat...
- 8
- 499
- 0
Tài liệu Báo cáo khoa học: Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum) ppt
... forward)25¢-ACAAA (A < /b> ⁄ C )A(< /b> A ⁄ G) (A < /b> ⁄ G ⁄ T )A(< /b> C ⁄ T) (A < /b> ⁄ C ⁄ G)ACACCACAAGACC)3¢ PsCIPK (degenerate reverse)35¢-CTTAT(C ⁄ G)AACAAGGAA (A < /b> ⁄ C)AATTTC-3¢ PsCBL (degenerate forward)45¢-GTATCAGCTTC(C ⁄ T)TCAAATGTC-3¢ ... PsCBL (degenerate reverse)55¢-CCATCACAAGAAACTAGAGAAAC-3 PsCIPK (5¢UTR forward)65¢-TTAAGTACTATAAAT-ACACAGCCTA-3¢ PsCIPK (3¢UTR reverse)75¢-CGAGCTCACTGCCTCTCAAC-3¢ PsCBL (5¢UTR forward)85¢-ACTCGTAGC-ACAGAGACAGAG-3¢ ... various abiotic and < /b> bioticstresses, and < /b> to calcium and < /b> salicylic acid, but not toabscisic acid (ABA) or dehydration. PsCIPK showeddual localization (in the < /b> cytosol and < /b> the < /b> plasma mem-brane)...
- 19
- 706
- 0
Báo cáo khoa học: Cloning, expression and characterization of a new aspartate aminotransferase from Bacillus subtilis B3 docx
... animals,plants and < /b> prokaryotes. The < /b> AATs from B. subtilis B3 and < /b> B. circulans clustered together with other bacterialAATs and < /b> appeared to be more closely related to the< /b> Ib-type of < /b> bacterial AATs than ... 2C). In the < /b> paper chromatography analysis of< /b> amino acids (Fig. 3), the < /b> AATB3 also demonstrated the < /b> ability to transfer the < /b> a-< /b> amino of < /b> the < /b> l-tryptophanto a-< /b> ketoglutarate and < /b> oxaloacetate to produce ... separatedby SDS ⁄ PAGE and < /b> stained with Coomassie Brilliant Blue. (B) Aliqu-ots of < /b> purified enzyme < /b> for the < /b> wild-type and < /b> each AATB3 mutantwere separated by native PAGE and < /b> stained with Coomassie...
- 13
- 490
- 0
Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf
... it h as been shown that t heyare capable of < /b> mediating a < /b> response by regulating gene< /b> expression < /b> [6,7]. Analysis of < /b> Arabidopsis thaliana mutantsimpaired in either JA biosynthe sis or signalling, ... berestored by application of < /b> linolenate or JA. Another mutant– opr3 – a < /b> rrests jasmonate biosynthesis at the < /b> OPDA level and < /b> is incapable of < /b> metabolizing exogenously appliedOPDA to JA [10]. opr3 mutants ... scions. A < /b> strong candidate for a < /b> transmissible jasmonate signal is the < /b> JA-conjugate, MeJA. The < /b> volatile ester can diffusethrough membranes and < /b> c an be found in the < /b> headspaceabove w ounded leaves...
- 8
- 458
- 1
Báo cáo khoa học: Cloning, characterization and localization of a novel basic peroxidase gene from Catharanthus roseus potx
... characterization and < /b> localization of < /b> a < /b> novel basicperoxidase gene < /b> from Catharanthus roseusSantosh Kumar, Ajaswrata Dutta, Alok K. Sinha and < /b> Jayanti SenNational Centre for Plant Genome Research, ... cotton (COTPROXDS) (AAA99868), barley grain (BP1) (AAA32973),Ar. thaliana (ATP 2A)< /b> A2< /b> (Q42578) and < /b> HRP-C (AAA33377). Residue numbers start at the < /b> putative mature proteins by analogy with HRP-C.Preprotein ... biosyn-thetic pathway. The < /b> final dimerization step of < /b> this pathway, leading to the< /b> synthesis of < /b> a < /b> dimeric alkaloid, vinblastine, was demonstrated to be cata-lyzed by a < /b> basic peroxidase. However,...
- 14
- 347
- 0
Báo cáo khoa học: Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca pptx
... Xeg74 was cloned into pET2 6b using the< /b> T. fusca Cel 6A < /b> signal sequence (MRMSPRPLRALLGAAAAALVSAAALAFPSQAA) in place of < /b> its nativesignal sequence. Cel 6A,< /b> Cel6Acd, and < /b> Cel4 8A < /b> have beenexpressed and < /b> ... to be an importantorganism in the < /b> degradation of < /b> biomass. Six T. fuscacellulase genes and < /b> a < /b> xylanase gene < /b> have been cloned,expressed and < /b> characterized [8–11]. The < /b> genome of < /b> thisorganism has ... (Km )and< /b> maximal rate (Vmax) values were calculated from a < /b> plot of< /b> the < /b> initial reaction rates vs. substrate concentration usingKaleidagraph (SYNERGYSoftware) to fit the < /b> data to the< /b> Michaelis-Menten equation.All...
- 9
- 453
- 0
Tài liệu Báo cáo khóa học: Cloning and characterization of two distinct isoforms of rainbow trout heat shock factor 1 ppt
... follows: HSF 1a < /b> forward,5¢-GAAGCAGCTTGTCCAGTACACCAA-3¢; HSF 1a< /b> reverse, 5¢-TTCCAAGAGCTGAACAAACCATTG-3¢;HSF 1b forward, 5¢-GAAGCAGCTGGTCCAGTACACCTC-3¢; HSF 1b reverse, 5¢-GGCTGAATAAACCATGCCAGTAGC-3¢; ... b 3) and < /b> two heterotrimers (a< /b> 2 b 1 and < /b> a< /b> 1 b 2). The < /b> existence of < /b> the < /b> four types of < /b> trimer may be reflected in the < /b> broadband migrating at 200 kDa in Fig. 7. On the < /b> other hand, a < /b> band corresponding ... (A)< /b> were compared. The< /b> percentage amino acid identity between rainbow trout HSF 1a < /b> orHSF 1b and < /b> other vertebrate HSF1s was calculated by the< /b> ALIGNprogram inLASERGENEsoftware.Ó FEBS 2004 Rainbow...
- 10
- 538
- 0
Tài liệu Báo cáo khoa học: Cloning, characterization and expression analysis of interleukin-10 from the common carp, Cyprinus carpio L. docx
... forward2GACTGTTGCTCATTTGTGGAIL-10 reverse2 GAGGCTAGATACTGCTCGATGTIL-10 forward3 TGATGATTTGGAACCATTATTGAAIL-10 reverse3 CACCTTTTTCCTTCATCTTTTCAT b- Actin forward1 ACTACCTCATGAAGATCCTG b- Actin ... Cloning,< /b> characterization and < /b> expression < /b> analysis of < /b> interleukin-10from the < /b> common carp,Cyprinus carpioL.Ram Savan1, Daisuke Igawa2 and < /b> Masahiro Sakai21United Graduate School of < /b> Agricultural ... gave a < /b> specific product of< /b> 284 bp. A < /b> set of < /b> b- actin primers (forward:5¢-ACTACCTCATGAAGATCCTG-3¢ and < /b> reverse:5¢-TTGCTGACCACATCTGCTG-3¢) served as a < /b> controlfor the < /b> quantity and < /b> quality of < /b> cDNA.Semiquantitative...
- 8
- 584
- 0
Báo cáo khoa học: Cloning and characterization of the genes encoding toxic lectins in mistletoe (Viscum album L) pot
... and< /b> XhoIML2p A-< /b> chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACCTCGAGTTATTAAGAAGAAGACGGACGGTCCCGGCATAC-3¢NdeI and< /b> XhoIML3p A-< /b> chain5¢-GATATACATATGTACCGTCGTATTAGCCTTCGTGTCACGGAT-3¢5¢-CACACGAATTCTTATTAAGAAGAAGAAGAACGGTCCCTGCATAC-3¢NdeI and< /b> EcoRIML3.1p A-< /b> chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACGAATTCTTATTAAGAAGAAGAAGAACGGTCCCTGCATAC-3¢NdeI ... (UTR)obtained by RACE. The < /b> sequences of < /b> the < /b> primers were:5¢AAAATCTAGAGAAGCAAGGAACAATGAATG-3¢(5¢UTR) containing the < /b> XbaI recognition site for cloning,< /b> 5¢-AAAAATGCATGAAGTTGATTGCTTGCATTAACTCAT-3¢ ... cloning< /b> ML1p A-< /b> chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACCTCGAGTTATTAAGAAGAAGACGGACGCTCACCGCA-3¢NdeI and< /b> XhoIML2p A-< /b> chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACCTCGAGTTATTAAGAAGAAGACGGACGGTCCCGGCATAC-3¢NdeI...
- 11
- 610
- 0
Báo cáo khoa học: Cloning, expression and interaction of human T-cell receptors with the bacterial superantigen SSA ppt
... indicated clonal expansion of < /b> T-cells bearinghuman Vb3, Vb12, Vb17 and < /b> Vb19 [20]. Others showedproliferation of < /b> human T-cells bearing Vb1, V b2 , Vb3,Vb5.2, Vb12, Vb15 and < /b> Vb17 domains and < /b> found ... treatment of < /b> several pathologies and < /b> because of < /b> the< /b> potential use of < /b> the < /b> toxins as biological weapons. Alteration of < /b> their MHC and < /b> TCR binding capacity by site directedmutagenesis could be useful ... 5¢-CATGCCATGGCCAGTAGTCAGCCTGACCCTACTCCAG-3¢ and < /b> 3¢ primer, 5¢-GGTTATCATATAAAGATCTCAAATTACCC-3¢, for the < /b> second PCR the < /b> primers were: 5¢ primer, 5¢-GGGTAATTTGAGATCTTTATATGATAACC-3¢ and < /b> 3¢ primer, 5¢-CGCGCGGGATCCTTAGTGATGGTGATGGTGATGGGTGACCGGTTTTTTGGTAGGTGAAC-3¢.ThethirdPCRwascarried...
- 9
- 485
- 0
Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họcNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíChuong 2 nhận dạng rui roQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)