Báo cáo khoa học: "Morphological Richness Offsets Resource Demand- Experiences in Constructing a POS Tagger for Hindi" potx

... Maharashtra, India {smriti,kuhoo,manshri,pb}@cse.iitb.ac .in Manish Shrivastava Pushpak Bhattacharyya Abstract In this paper we report our work on building a POS tagger for a morpholog- ically rich language- ... identification. References A. Ratnaparakhi. 1996. A Maximum Entropy Part- Of-Speech Tagger. EMNLP 1996 A. Bharati, V. Chaitanya, R. Sangal 1995. Natural Language Proc...

Ngày tải lên: 31/03/2014, 01:20

... helix-turn-helix DNA-binding domain. In Rv0386, the standard substrate, adenine-defining lysine-aspartate couple is replaced by glutamine-asparagine. The recombin- ant adenylyl cyclase domain was active with a V max of ... substrate specificity are replaced in a non- conservative manner, glutamine-asparagine instead of lysine-aspartate. All mammalian membrane-bound ACs possess a stric...

Ngày tải lên: 07/03/2014, 21:20

... 2008) doi:10.1111/j.1742-4658.2008.06749.x An active site aspartate residue, Asp97, in the methionine aminopeptidase (MetAPs) from Escherichia coli (EcMetAP-I) was mutated to alanine, glu- tamate, and asparagine. Asp97 is the lone carboxylate ... conserved aspartate in human prolidase by aspara- gine causes skin abnormalities, recurrent infections, and mental retardation [45]. On the basi...

Ngày tải lên: 30/03/2014, 02:20

... following rule with two constraints matches parses with case feature ablative, preceding a parse matching a postposition subcategorizing for an ablative nominal form. [ [case : abl] , [cat : postp, ... as in 1 and 2 below. 6. The same suffix appears in different positions in the morphotactic paradigm conveying different information as in 2 and 3 below. 1. uygulama / (appl...

Ngày tải lên: 08/03/2014, 21:20

... TOC(0)(Beginning) Kanji, Hiragana, Number, Katakana, Alphabet (5:5) 19 TOC(0)(End) Kanji, Hiragana, Number, Katakana, Alphabet (5:5) 20 TOC(0)(Transition) Kanji→Hiragana, Number→Kanji, Katakana→Kanji, ... morphemes, are transliterated into katakana characters by using a dictionary, and then they are aligned with pronunciation in the CSJ by using a dynamic programming method. In this p...

Ngày tải lên: 17/03/2014, 06:20

... providing a natural language front end to a database, information extraction, machine trans- lation, and task-oriented dialogue understanding all require lexical semantics. The lexical semantic ... However, this ap- proach is hindered by the need for a large amount of initial lexical semantic information and the need for a robust natural language understanding system that pro...

Ngày tải lên: 17/03/2014, 09:20

... NAFTA NP (T PRED) = 'NAFTA' Ta ~ NAFTA Semantic information is expressed in (1) a mean- ing language and (2) a language for assembling meanings, or glue language. The meaning ... 'copying' an argument of higher type, such as a quantifier in the case of coordinated inten- sional verbs. They propose a 'processing strat- egy' requiring tha...

Ngày tải lên: 24/03/2014, 05:21

... Ewing’s sarcoma (EWS) oncogene contains an N-terminal transcrip- tion activation domain and a C-terminal RNA-binding domain. Although the EWS activation domain is a potent transactivation domain ... C), for pGEX–EWS; EAD forward d(CGG AAT TCA TGG CGT CCA CGG ATT ACA G) and EAD reverse d(CGC TCG AGT CAT CCG GAA AAT CCT CCA GAC T), for pGEX–EAD; RGG1 forward d(CGG AAT TCC CAG GAG AGA AC...

Ngày tải lên: 15/02/2014, 01:20

... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYR RHDLS ... was shown that the broad-complex, tramtrack and bric -a- brac domain containing protein KCTD1 directly binds to AP- 2a and acts as a negative regulator for AP- 2a trans- activation [...

Ngày tải lên: 16/02/2014, 09:20

... primers: forward, 5¢-CACCAAACCTTATACGATTGATAAGGCA AAC-3¢; and reverse, 5¢-TTATTATTGGGCGTAAGCT TCTAG-3¢. The construct was cloned directly into the pET151 expression vector by a Directional TOPO cloning technique ... chain B. Chain A Chain B Hydrogen bonds Ala25 Asn77, Arg80 AlaO–ArgNH1 AlaO–ArgND2 Asn26 His35, Arg80, Asn39 AsnOD1–ArgNH1 AsnOD1–HisNE2 Ser28 Arg76 Trp30 Arg42, Trp30, Arg76...

Ngày tải lên: 16/02/2014, 14:20