Báo cáo khoa học: A human-specific TNF-responsive promoter for Goodpasture antigen-binding protein potx

... man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans ... c-N-methylamino- butyrate oxidase; megaplasmid pAO1; nicotine degradation; sarcosine o xidase. The bacterial soil community plays a pivotal role in the biodegradation of a n a lmost unlimited...

Ngày tải lên: 19/02/2014, 16:20

... relevant for her own research. As an example of such a co-citation consider the following citation sentence: Various machine learning approaches have been proposed for chunking (Ramshaw and Marcus, 1995; ... user a multi-document summary. typical evaluation of a multi-document summariza- tion system, gold standard summaries are created by hand and then compared against fixed length g...

Ngày tải lên: 17/03/2014, 00:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4...

Ngày tải lên: 18/02/2014, 08:20

... that treating AA as a text classifica- tion problem is viable, but the feature types are all fairly shallow, and the approach doesn’t make effi- cient use of the training data as a separate classifier is ... extract an error-rate in a way that doesn’t require manually tagged data. However, we also use an error-rate calculated from the CLC error tags to ob- tain an upper bound for the per...

Ngày tải lên: 20/02/2014, 04:20

... significant improvements on various language-pairs, one issue is that matching syn- tactic analysis can not always guarantee a good translation, and violating syntactic structure does not always ... equation (3) or equation (4), which estimates a probability that a source span is to be translated as a unit within partic- ular syntactic contexts. If a source span can be translated as...

Ngày tải lên: 20/02/2014, 07:20

... fact that there is often a good deal of overlap in words between the reparandum and the alteration, as speakers may trace back several words when restarting after an er- ror. For instance, in ... modified for use in a special repair grammar, which not only reduces the amount of available training data, but violates our intuition that most reparanda are fluent up until the actual edit oc...

Ngày tải lên: 20/02/2014, 09:20

... for many practical applications. Deterministic parsing has emerged as an attrac- tive alternative to probabilistic parsing, offering accuracy just below the state-of-the-art in syn- tactic analysis ... outputs this as a partial parse. Sagae and Lavie (2005) have shown that this algorithm has linear time complexity, assuming that classifica- tion takes constant time. The next example il- lu...

Ngày tải lên: 20/02/2014, 12:20

... Normalization versus Text Para- phrasing Problem Others may regard SMS normalization as a para- phrasing problem. Broadly speaking, paraphrases capture core aspects of variability in language, ... normaliza- tion and translation. Bangalore et al. (2002) used 33 a consensus translation technique to bootstrap parallel data using off-the-shelf translation sys- tems for training a hie...

Ngày tải lên: 20/02/2014, 12:20

... arguments, Arg0 is the Agent, Arg1 is Patient, etc. ArgM- may indicate adjunct arguments, such as Locative, Temporal. Many researchers (Gildea and Jurafsky, 2002; Pradhan et al., 200 5a) use feature-based ... Predicate Argument Feature space necessity of syntactic parsing for semantic role la- beling. However, the standard flat features cannot model the syntactic information well. A predic...

Ngày tải lên: 20/02/2014, 12:20

... the top L entries are selected. Because each state that gets expanded in the inner loop has out-degree 2, the new state map N will contain at most 2L states. This means that we have an additional loop invariant: ... runs in quartic time, but an approximate cubic-time variant is indistinguishable in practice. A quadratic-time approximation makes very few mistakes and remains practically usef...

Ngày tải lên: 20/02/2014, 12:20