Báo cáo khoa học: A human-specific TNF-responsive promoter for Goodpasture antigen-binding protein potx
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... man-made organic compounds, among them the
tobacco alkaloid nicotine. Perhaps analysed in greatest
detail is the pathway of nicotine degradation as it takes
place in Arthrobacter nicotinovorans ... c-N-methylamino-
butyrate oxidase; megaplasmid pAO1; nicotine degradation;
sarcosine o xidase.
The bacterial soil community plays a pivotal role in the
biodegradation of a n a lmost unlimited...
Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx
... relevant for her own
research.
As an example of such a co-citation consider the
following citation sentence:
Various machine learning approaches have been
proposed for chunking (Ramshaw and Marcus,
1995; ... user a multi-document summary.
typical evaluation of a multi-document summariza-
tion system, gold standard summaries are created by
hand and then compared against fixed length g...
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335
E.
coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321
A.
pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-
gen 911 was a gift from Kao Chemical (Tokyo, Japan).
NADPH, NADH and NADP
+
were purchased from
Oriental Yeast (Tokyo, Japan). a- Cyano-4...
Tài liệu Báo cáo khoa học: "A New Dataset and Method for Automatically Grading ESOL Texts" pdf
... that treating AA as a text classifica-
tion problem is viable, but the feature types are all
fairly shallow, and the approach doesn’t make effi-
cient use of the training data as a separate classifier
is ... extract an error-rate in a way that doesn’t require
manually tagged data. However, we also use an
error-rate calculated from the CLC error tags to ob-
tain an upper bound for the per...
Tài liệu Báo cáo khoa học: "A Syntax-Driven Bracketing Model for Phrase-Based Translation" pptx
... significant improvements on various
language-pairs, one issue is that matching syn-
tactic analysis can not always guarantee a good
translation, and violating syntactic structure does
not always ... equation (3) or equation
(4), which estimates a probability that a source
span is to be translated as a unit within partic-
ular syntactic contexts. If a source span can be
translated as...
Tài liệu Báo cáo khoa học: "A Unified Syntactic Model for Parsing Fluent and Disfluent Speech∗" ppt
... fact that there
is often a good deal of overlap in words between
the reparandum and the alteration, as speakers may
trace back several words when restarting after an er-
ror. For instance, in ... modified for use in a special
repair grammar, which not only reduces the amount
of available training data, but violates our intuition
that most reparanda are fluent up until the actual edit
oc...
Tài liệu Báo cáo khoa học: "A Fast, Accurate Deterministic Parser for Chinese" pdf
... for many practical applications.
Deterministic parsing has emerged as an attrac-
tive alternative to probabilistic parsing, offering
accuracy just below the state-of-the-art in syn-
tactic analysis ... outputs this as a partial parse. Sagae and
Lavie (2005) have shown that this algorithm has
linear time complexity, assuming that classifica-
tion takes constant time. The next example il-
lu...
Tài liệu Báo cáo khoa học: "A Phrase-based Statistical Model for SMS Text Normalization" ppt
... Normalization versus Text Para-
phrasing Problem
Others may regard SMS normalization as a para-
phrasing problem. Broadly speaking, paraphrases
capture core aspects of variability in language, ... normaliza-
tion and translation. Bangalore et al. (2002) used
33
a consensus translation technique to bootstrap
parallel data using off-the-shelf translation sys-
tems for training a hie...
Tài liệu Báo cáo khoa học: "A Hybrid Convolution Tree Kernel for Semantic Role Labeling" pptx
... arguments,
Arg0 is the Agent, Arg1 is Patient, etc. ArgM-
may indicate adjunct arguments, such as Locative,
Temporal.
Many researchers (Gildea and Jurafsky, 2002;
Pradhan et al., 200 5a) use feature-based ... Predicate Argument Feature space
necessity of syntactic parsing for semantic role la-
beling. However, the standard flat features cannot
model the syntactic information well. A predic...
Tài liệu Báo cáo khoa học: "A Maximum Expected Utility Framework for Binary Sequence Labeling" doc
... the
top
L
entries are selected. Because each state that
gets expanded in the inner loop has out-degree 2, the
new state map
N
will contain at most
2L
states. This
means that we have an additional loop invariant: ... runs
in quartic time, but an approximate cubic-time variant
is indistinguishable in practice. A quadratic-time
approximation makes very few mistakes and remains
practically usef...
Từ khóa: