Báo cáo khoa học: A novel carbonic anhydrase from the giant clam Tridacna gigas contains two carbonic anhydrase domains pptx
Báo cáo khoa học: A novel carbonic anhydrase from the giant clam Tridacna gigas contains two carbonic anhydrase domains pptx
... A novel carbonic anhydrase from the giant clam Tridacna gigas contains two carbonic anhydrase domains William Leggat1,2, Ross Dixon1, Said Saleh1and David Yellowlees11 Biochemistry and ... 2000 TACAG gttggg ttacag CTCAA7910 1380 a TCAAG gtatgt ttacag GAGTG8 1093 950 TACAA gtactt ctacag TCCAA9 1242 1100 TCGAG gtactg tttcag CTACA10 1335 1370 TTGAA gtaagt tttcag ATCGG11 ... describes the presence of a unique dual domain carbonic anhydrase (CA) in the giant clam, Tridacna gigas. CA plays an importantrole in the movement of inorganic carbon (Ci) from the surrounding sea-water...
- 9
- 350
- 0
Báo cáo khoa học: A novel phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona pptx
... phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nipponaTetsuro Samata, Daisuke Ikeda, Aya Kajikawa, Hideyoshi Sato, Chihiro Nogawa, Daishi Yamada,Ryo Yamazaki and Takahiro AkiyamaLaboratory ... (1996) A carbonic anhydrase from the nacreous layer in oyster pearls. Proc Natl AcadSci USA 93, 9657–9660.2 Sudo S, Fujikawa T, Nagakura T, Ohkubo T, Sakagu-chi K, Tanaka M, Nakashima K & Takahashi ... Murayama E, Inoue H, Ozaki N, Tohse H,Kogure T & Nagasawa H (2004) Characterization ofPrismalin-14, a novel matrix protein from the prismaticlayer of the Japanese pearl oyster (Pinctada fucata).Biochem...
- 13
- 425
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... num-bers in parentheses indicate the Tmvalue of each protein at neutralpH. a Data from this study.bData from Griffin et al. [32].cData from Yano et al. [4].T. Mandai et al. Thermostable electron...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of...
- 12
- 613
- 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki ... in the common octopus (Octopus vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone...
- 11
- 595
- 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... CumOOH, and NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained from Beijing Chemical ... such asinstability, antigenicity and poor availability, muchattention has been paid to its artificial imitation [9,10].In synthetic approaches, an initial attempt is madeto synthesize organoselenium ... has the same catalyticmechanism as native GPX. From the steady-state equa-tion, the kinetic parameters were obtained (Table 2).During investigation of the reduction of peroxides, itis natural...
- 9
- 491
- 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, and endowed with unusual metabolic capabilities for the degradation of aromatic hydrocarbons ... KOH. The lipo-oligosaccharide was also analyzed after acid treatment,attained by mild hydrolysis with acetic acid, to obtaininformation on the nature of the phosphate and acyl groups. The two ... the characteristic monosaccharide residues, a largenumber of phosphate groups at the proper location, a carbamoyl moiety, and an acetyl group.It is worth noting that the nature and the localization...
- 14
- 715
- 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... NADPH, and glutamate dehydrogenasewere from Wako Pure Chemicals (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentafluorophenylhydrazine was ... and2-aminomuconic acid in the modified meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been purified andcharacterized in detail [5,6]. The nucleotide ... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate...
- 7
- 613
- 1
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation ... soil bacteria.MABO may have evolved from a sarcosine oxidase byadjustment of the c atalytic centre to a ccommodate the increased length of the carbohydrate chain.MABO exhibits, like the mitochondrial ... using the primer pair 5¢-GCAGCGGCACCTCTTCTCACGCCGCAGGCTTG-3¢ and 5¢-CA AGCCTGCGGCGTGAGAAGAGGTGCCGCTGC-3¢ for the W66S mutant, and by using the primer pair5¢-GCCAC CTCTTTCCACGCCGCAGGC-3¢ and...
- 8
- 647
- 0
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information ... insufficient training data. Intuitively we can follow the path of “Nested ⇒ Adjacent ⇒ Separated ⇒ Others” (Nested, Adjacent and Separated structures are majority in the corpus) to perform the inference. ... expected. The lack of necessary co-referenced mentions might be the main reason. 2 Related Work Many approaches have been proposed in the literature of relation extraction. Among them, feature-based...
- 4
- 479
- 0
Từ khóa: chuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấpMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)chuong 1 tong quan quan tri rui roGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ