Báo cáo khoa học: A novel R-stereoselective amidase from Pseudomonas sp MCI3434 acting on piperazine-2-tert-butylcarboxamide pdf
Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase specific for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx
... L-Ala-(Gly) 2 (L-Ala) 2 , L-Ala-D-Ala, L-Ala-D-Ala-L-Ala, DL-Ala-DL-Asn, DL-Ala-DL-Ile, DL-Ala-DL-Leu, DL-Ala-DL-Met, DL-Ala- DL-Phe, DL-Ala-DL-Ser, DL-Ala-DL-Val, L-Asp-D-Ala, L-Pro-Gly, L-Pro- L-Phe, c-Aminobutyryl-L-His ... 5¢-CACTTG AAGCTTTAAGGAGGA AtagACCATGCGTATCCGTGAGCTTGGCATCACC-3¢; antisen se primer, 5¢-ACGCAA TCTAGAGTCAGCCCTCA GGGGGCTTTCG-3¢. The amplified PCR product was digested wi...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: A novel R-stereoselective amidase from Pseudomonas sp. MCI3434 acting on piperazine-2-tert-butylcarboxamide pdf
... 5¢-GGCTCA AA GCTTTAAGGAGGAAtagGAGATGAAAATTGAATT GGTGCAACTGG-3¢; antisense primer, 5¢-CATAGTG TT TCTAGACTTCATTGGCTGGC-3¢. The amplified PCR product was digested with HindIII and XbaI, separ- ated by agarose ... and characterization of the R -stereoselective amidase from Pseudomonas sp. MCI3434 An amidase, acting on piperazine-2-tert-butylcarboxamide was detected in Pseudomonas...
Ngày tải lên: 30/03/2014, 13:20
Báo cáo khoa học: A novel carbonic anhydrase from the giant clam Tridacna gigas contains two carbonic anhydrase domains pptx
... 2000 TACAG gttggg ttacag CTCAA 7910 1380 a TCAAG gtatgt ttacag GAGTG 8 1093 950 TACAA gtactt ctacag TCCAA 9 1242 1100 TCGAG gtactg tttcag CTACA 10 1335 1370 TTGAA gtaagt tttcag ATCGG 11 ... acceptor 1265 1040 CACGG gtaaac ttccag TGGTA 2417 956 a TTGAG gtaggt ttgtag GTACA 3510 1200 TTGAG gtgggt ttctag ATCGA 4583 1830 TAAAA gttagt ttctag ATGGA 5744 2280 CTCAG gtatat tttcag...
Ngày tải lên: 30/03/2014, 20:20
Báo cáo khoa học: to 3a-hydroxysteroid dehydrogenase from Pseudomonas sp. B-0831 using fluorescence stopped-flow procedures pptx
... Biophys. Acta 450, 142–153. 5. Uwajima, T., Takayama, K. & Terada, O. (1978) Production, purification and crystallization of 3a- hydroxysterid dehydro- genase from Pseudomonas putida. Agric. ... Shigeyuki Imamura 1 and Masatake Ohnishi 2 1 Department Diagnostics Research and Development, Division of Fine Chemicals and Diagnostics, Asahi Kasei Pharma Corporation, Shizuoka, Japan; 2 Depa...
Ngày tải lên: 07/03/2014, 15:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... 700 Absorbance Fig. 1. Purification and characterization of Fdx from T. thermophilus HB27. (A) SDS ⁄ PAGE of fractions containing Fdx at each step of purification. SDS ⁄ PAGE was carri...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... receptors, and invertebrate tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and ... peptides and their receptors in the common octopus (Octopus vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characte...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid reacts with malonal- dehyde and ⁄ or other carbonyl by-products of free-ra...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... Catania, Italy Pseudomonas stutzeri OXI is a Gram-negative microorgan- ism able to grow in media containing aromatic hydrocar- bons. A novel lipo-oligosaccharide from P. stutzeri OX1 was isolated ... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Es...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... the deaminase. Pseudomonas sp. strain A P-3 and Pseudomonas pseudo- alcaligenes strain JS45 convert 2 -aminophenol to 4-oxalo- crotonic acid via 2-aminomuconic 6-semialdehyde and 2-aminomuconic acid ... NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylh...
Ngày tải lên: 19/02/2014, 16:20