Báo cáo khoa học: A novel phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona pptx

... oyster Crassostrea nippona Tetsuro Samata, Daisuke Ikeda, Aya Kajikawa, Hideyoshi Sato, Chihiro Nogawa, Daishi Yamada, Ryo Yamazaki and Takahiro Akiyama Laboratory of Cell Biology, Faculty of Environmental ... molecular mass standards; lane A, CBB staining; lane B, Stains-all staining; lane C, negative staining; lane D, Methyl green staining. Arrows on the right side of the l...

Ngày tải lên: 30/03/2014, 04:20

... formation of purine base was measured by HPLC using a Beckman system Gold apparatus. The amount of purine base formed is determined by measuring the percentage of the absorbance integrated peak area ... time kinet- ics of thermal denaturation. The diagram of the residual activity after 5 min of preincubation as a func- tion of temperature, reported in Fig. 2A is...

Ngày tải lên: 16/03/2014, 18:20

... Journal compilation ª 2010 FEBS A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1 Richa Basundra 1, *, Akinchan Kumar 1, *, Samir Amrane 2, *, Anjali Verma 1 , Anh ... human and Giardia telomeric DNA sequences containing four tracts of three consecutive guanines can form intramolecular AAATCTCCCGCCAGGTCAGCGGCCGGGCGCTGATTGGCCCCATGGCGGCGGGGCCGGC TCGTGATT...

Ngày tải lên: 29/03/2014, 21:20

... 5¢-GTTCACCACCAGAAGCT GGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAG GGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab- start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, ... 5¢-CCTGCCGAGCTCCTATTA CACAACGCCACCAACCATCAG-3¢. The PCR solution was prepared in the buffer supplied with the enzyme, and contained Aba, Abb and Abcat 40 nm each, and the start and st...

Ngày tải lên: 18/02/2014, 13:20

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAY...

Ngày tải lên: 18/02/2014, 08:20

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... Relative fluorescence intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs...

Ngày tải lên: 18/02/2014, 18:20

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... into tachykinin-related peptides, their receptors, and invertebrate tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Min...

Ngày tải lên: 19/02/2014, 00:20

... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size and shape of the substrates, and second, incorporation of an imido-group increases the stability of transition state...

Ngày tải lên: 19/02/2014, 02:20

... Thomas-Oates, J.E. & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... which links the O-7 of a Hep residue, and a 2-amino-2-deoxy galactose (GalN), which is the branching point of the oligosaccharide. The amino function of the GalN resid...

Ngày tải lên: 19/02/2014, 13:20

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and 2-aminomuconic acid in the modified meta-cleavage path- way (Fig. 1B). The 2-aminomuconate deaminase from s train AP-3 and that from strain JS45 have been puri...

Ngày tải lên: 19/02/2014, 16:20