Báo cáo khoa học: A novel phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona pptx

... oyster Crassostrea nippona Tetsuro Samata, Daisuke Ikeda, Aya Kajikawa, Hideyoshi Sato, Chihiro Nogawa, Daishi Yamada,Ryo Yamazaki and Takahiro AkiyamaLaboratory of Cell Biology, Faculty of Environmental ... molecular mass standards; lane A, CBB staining; lane B,Stains-all staining; lane C, negative staining; lane D, Methyl greenstaining. Arrows on the right side of the lanes indicate the position of ... Murayama E, Inoue H, Ozaki N, Tohse H,Kogure T & Nagasawa H (2004) Characterization of Prismalin-14, a novel matrix protein from the prismaticlayer of the Japanese pearl oyster (Pinctada fucata).Biochem...

Báo cáo khoa học: A novel hyperthermostable 5¢-deoxy-5¢-methylthioadenosine phosphorylase from the archaeon Sulfolobus solfataricus pdf

... formation of purine base was measured byHPLC using a Beckman system Gold apparatus. The amount of purine base formed is determined by measuring the percentage of the absorbance integrated peak area ... time kinet-ics of thermal denaturation. The diagram of the residual activity after 5 min of preincubation as a func-tion of temperature, reported in Fig. 2A is character-ized by a sharp transition. ... forcatalytic activity, shows the same speciﬁc activity of the native form.Substrate-induced conformational changes The features of unusual stability of SsMTAPII againstthermal inactivation and its notably...

Báo cáo khoa học: A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1 docx

... Journal compilation ª 2010 FEBS A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1Richa Basundra1,*, Akinchan Kumar1,*, Samir Amrane2,*, Anjali Verma1, Anh ... human and Giardiatelomeric DNA sequences containing four tracts of three consecutive guanines can form intramolecularAAATCTCCCGCCAGGTCAGCGGCCGGGCGCTGATTGGCCCCATGGCGGCGGGGCCGGCTCGTGATTGGCCAGCACGCCGTGGTTTAAAGCGGTCGGCGCGGGAACCAGGGGCTTACTGCGGGACGGCCTTGGAGAGTACTCGGGTTCGTGAACTTCCCGGAGGCGCAATGAGCT A BLoop35′3′Loop2Loop1GGGGGGGGFig. ... Uesugi S & Katahira M(2003) Intramolecular higher order packing of parallelquadruplexes comprising a G:G:G:G tetrad and a G( :A) :G( :A) :G( :A) :G heptad of GGA triplet repeatDNA. J Biol Chem...

Tài liệu Báo cáo khoa học: A facile method for expression and puriﬁcation of the Alzheimer’s disease-associated amyloid b-peptide pdf

... 5¢-GTTCACCACCAGAAGCTGGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAGGGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGACCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab-start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATTCCGTCACG-3¢;Abstop, ... 5¢-CCTGCCGAGCTCCTATTACACAACGCCACCAACCATCAG-3¢. The PCR solution was prepared in the buffer suppliedwith the enzyme, and contained Aba, Abb and Abcat40 nm each, and the start and stop primers Abstart ... containing 8 m urea, and the sample was elutedwith a gradient of 0–300 mm NaCl in buffer A containing8 m urea.Mass spectrometry, amino acid analysis andsequencingAmino acid analysis was performed...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... summarized in Table 2. The puriﬁed proteinwas analyzed by MALDI-TOF-MS. Peptide mass ﬁn-gerprinting was used to search the NCBInr databaseusing mascot. The result of the mascot searchsuggested that...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... Relativeﬂuorescence intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation ... evidence of an additionaloccludin variant deleted in exon 9 (OccDE9). On the basis of a comparative analysis of the involvement of wild-type occludin (OccWT) and variant occludin in apoptosis and...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris....

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size andshape of the substrates, and second, incorporation of an imido-group increases the stability of transitionstate selenolate in the catalytic ... GSH, indicating that incorporation of the imido-group in the proximity of the selenium atom mayincrease the stability of the nucleophilic intermediateselenolate and enhance GPX-like activity in...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... which links the O-7 of a Hep residue, and a 2-amino-2-deoxy galactose (GalN), which is the branchingpoint of the oligosaccharide. The amino function of the GalNresidue is frequently acylated ... KOH. The lipo-oligosaccharide was also analyzed after acid treatment,attained by mild hydrolysis with acetic acid, to obtaininformation on the nature of the phosphate and acyl groups. The two...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and2-aminomuconic acid in the modiﬁed meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been puriﬁed andcharacterized in detail [5,6]. The nucleotide ... restingcells of a mutant, strain Y-2, of the aniline-assimilatingPseudomonas sp. strain AW-2 [20].ResultsSpectral changes during metabolism of 4-amino-3-hydroxybenzoic acid by crude extracts of strain...

Xem thêm