Báo cáo khoa học: A novel, promoter-based, target-specific assay identifies 2-deoxy-D-glucose as an inhibitor of globotriaosylceramide biosynthesis docx

... processes such as transport, protein synthesis, catabolism and metabolism [1]. It can also protect cells against reactive oxygen species and help them maintain an adequate intracellular redox status [2]. ... solution was measured at 365 ⁄ 480 nm. The GSH content of the plasma was derived from the standard curve and the regression equation. The average recovery test was made using the st...

Ngày tải lên: 07/03/2014, 05:20

... Furukawa 2 and Ken-ichi Nakayama 1 1 Glycolipids Function Analysis Team, Health Technology Research Center, National Institute of Advanced Industrial Science and Technology, Kagawa, Japan 2 Department ... synthase gene; Gb4, globotetraosylceramide (GalNAcb1,3Gala1,4LacCer); GD 1a, NeuAca2,3Galb1,3GalNAcb1,4(NeuAca2,3)LacCer; GD1b, Galb1,3GalNAcb1,4(NeuAca2,8NeuAca2,3)LacCer; GM1, Galb1,3Ga...

Ngày tải lên: 30/03/2014, 01:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by the manufacturer (Pro...

Ngày tải lên: 18/02/2014, 18:20

... tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-h...

Ngày tải lên: 19/02/2014, 00:20

... experi- ment carried out without the mimic, ascorbate, and ferrous sulfate was known as the control group. Biological analysis of mimics against mitochondrial damage Mitochondrial swelling was assayed as ... swelling and a decrease in mitochondria integrity. TBARS content in ferrous sulfate ⁄ ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this ass...

Ngày tải lên: 19/02/2014, 02:20

... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, ... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota...

Ngày tải lên: 19/02/2014, 13:20

... NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic...

Ngày tải lên: 19/02/2014, 16:20

... the biodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine ... Optitran BA-S 85; Schleicher & Schuell, Dassel, Germany). The membranes were decorated with MABO antiserum and developed by using alkaline phosphatase-conjugated anti-rabbit Ig...

Ngày tải lên: 19/02/2014, 16:20

... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically ... relation extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kerne...

Ngày tải lên: 20/02/2014, 09:20