Báo cáo khoa học: A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1 docx
Báo cáo khoa học: A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1 docx
... Journal compilation ª 2 010 FEBS A novel G-quadruplex motif modulates promoter activity of human thymidine kinase 1 Richa Basundra 1, *, Akinchan Kumar 1, *, Samir Amrane 2, *, Anjali Verma 1 , Anh ... intramolecular AAATCTCCCGCCAGGTCAGCGGCCGGGCGCTGATTGGCCCCATGGCGGCGGGGCCGGC TCGTGATTGGCCAGCACGCCGTGGTTTAAAGCGGTCGGCGCGGGAACCAGGGGCTTAC TGCGGGACGGCCTTGGAGAGTACTCGGGTT...
Ngày tải lên: 29/03/2014, 21:20
Báo cáo khoa học: A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif doc
... CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAG GGAT 1r TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC 2r CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG 3r GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCA Reverse GCTA GGATCCCTAGCAACCACGGCAC Table 2. Antifungal activity ... Odintsova 1 , Alexander A. Vassilevski 2 , Anna A. Slavokhotova 1 , Alexander K. Musolyamov 2 , Ekaterina I. Finkina 2 , Natalia V. Khadeeva 1 , Eugene...
Ngày tải lên: 07/03/2014, 02:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 3 21 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B). The addition of appropriate detergents or phospholip- ids was requir...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... Scotto-Lavino E, Du G & Frohman MA (2006) 3¢ End cDNA amplification using classic RACE. Nat Protoc 1, 2742–2745. 29 Szpaderska AM & Frankfater A (20 01) An intracellular form of cat...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... Journal compilation ª 2007 FEBS 10 0 80 60 40 20 0 [%] 10 -11 10 -10 10 -9 10 -8 10 -7 10 -6 10 0 80 60 40 20 0 [%] 10 -11 10 -10 10 -9 10 -8 10 -7 10 -6 10 0 80 60 40 20 0 [%] 10 -11 10 -10 10 -9 10 -8 10 -7 10 -6 10 0 80 60 40 20 0 [%] 10 -11 10 -10 10 -9 10 -8 10 -7 10 -6 10 0 80 60 40 20 0 [%] 10 -10 10 -9 10 -8 10 -7...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... peroxidase activity. J Am Chem Soc 11 1, 5936– 5939. 12 Iwaoka M & Tomoda S (19 94) A model study on the effect of an amino group on the antioxidant activity of glutathione peroxidase. J Am Chem ... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... region Serena Leone 1 , Viviana Izzo 2 , Alba Silipo 1 , Luisa Sturiale 3 , Domenico Garozzo 3 , Rosa Lanzetta 1 , Michelangelo Parrilli 1 , Antonio Molinaro 1 and Alberto Di Donato 2 1 Dipartimento ... Gram-negative bacteria, and their adaptability to many different pollutants [1] . Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc
... to sequences of 2-aminomuconate deaminases [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in th...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt
... the biodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine ... lLof c-N-aminobutyrate and 1 lLofc-N-methylaminobutyrate (lan e 4); 0.5 lL, 1 lL, 2 lL, 5 lLofa1mLenzymeassaywith10m M c-N-methy laminobutyrate as the s ubstrate and 10 lgofMA...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt
... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically ... basic unit features within each feature subspace can already achieve state -of- art performance, while over-inclusion of complex features might hurt the performance. Previous approache...
Ngày tải lên: 20/02/2014, 09:20