Báo cáo khoa học: A novel splicing variant form suppresses the activity of full-length signal transducer and activator of transcription 5A pot

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as...

Ngày tải lên: 18/02/2014, 18:20

... granulifera, Cassiopea xamachana, Condylactys gigantea, Gorgonia ventalina, Lebrunia danae, Palythoa caribaeorum, Physalia phy- salis, Plexaura homomalla, Stichodactyla helianthus and Zoanthus pulchellus); ... and contains more than 25 different variants Fig. 1. S. magnifica Phylum Annelida, Class Polychaeta, Subclass Palpata, Order Canalipalpata, Suborder Sabellida, Family Sabellidae, Gen...

Ngày tải lên: 07/03/2014, 02:20

... residues, vari- able oxidation of methionine and variable deamidation of asparagine and glutamine. Parent and fragment mass toler- ances were set to 1 Da. Up to two missed cleavages and half tryptic ... may speculate that hmeprin has activity similar to BMP-1 ⁄ TLD-like metalloendopeptidases in that it acts as a procollagen C protease as well as an activator of lysyl oxida...

Ngày tải lên: 07/03/2014, 06:20

... light adaptation of the eye. Light adaptation also induced the decrease of all-trans isomer both in the distal and proximal portions of the retina. In contrast, the increase of 11-cis ligand was ... using an ATTO AE6905C Image Saver, and quantified with NIH IMAGE program. The gel was then stained with Coomassie Brilliant Blue, and the protein content was measured vi...

Ngày tải lên: 17/03/2014, 03:20

... Both end-plate potentials of the ion trap were set at 1.5 V and the duration of the electron pulse was 100 ms. Data acquisition and handling Primary data analysis was performed on a workstation running ... ethanol, sonicated and extracted overnight at +4 °C [23]. After centri- fugation, the pellet was discarded and a sample of the supernatant was withdrawn for radi...

Ngày tải lên: 17/03/2014, 10:20

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... of the FNR (Fig. 5A) . The Fdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and the turnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was 4.9-fold greater than that at a rat...

Ngày tải lên: 18/02/2014, 08:20

... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... in the common octopus (Octopus vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization...

Ngày tải lên: 19/02/2014, 00:20

... steady-state kinetics of 6-CySeCD catalysis and investigated the antioxidant ability of 6-CySeCD using a mitochondria injury system. Results and Discussion Synthesis and characterization of 6-CySeCD The ... sulfate ⁄ ascorbate-induced mito- chondrial damage and the swelling is decreased by addition of 6-CySeCD. The absorbance at 520 nm for the control group was bas...

Ngày tải lên: 19/02/2014, 02:20

... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Escherichia ... OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, and endowed with unusual metabolic capabilities for the degradation of...

Ngày tải lên: 19/02/2014, 13:20

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... release of ammonia, are a key enzyme in the metabolic pathways of 2-amino phenol and its deriva- tives. However, little is known about the metabolic steps...

Ngày tải lên: 19/02/2014, 16:20