The Costs of Attaining the Millennium Development Goals * ppt

Tài liệu Public Choices, Private Decisions: Sexual and Reproductive Health and the Millennium Development Goals ppt

Tài liệu Public Choices, Private Decisions: Sexual and Reproductive Health and the Millennium Development Goals ppt

... with the UN Millennium Project, recognizes the Millennium Development Goals (MDGs) generated in the follow-up pro- cesses to the Millennium Summit as markers and priorities for the whole set of ... related to vary- ing degrees of attainment of priority development goals • Examination of the impact of the scenarios on the size and timing (i.e., the dyn...

Ngày tải lên: 13/02/2014, 10:20

197 346 0
Population, Reproductive Health and the Millennium Development Goals ppt

Population, Reproductive Health and the Millennium Development Goals ppt

... from the UN Millennium Project Reports June 2005 Population, Reproductive Health and the Millennium Development Goals 12 Population, Reproductive Health and the Millennium Development Goals an ... important international development objectives that are not included as one of the MDGs, but that are crucial to the achievement of the Goals. This box high- light...

Ngày tải lên: 22/03/2014, 12:20

36 312 0
PMTCT STraTegiC ViSion 2010–2015: Preventing mother-to-child transmission of HIV to reach the UNGASS and Millennium Development Goals docx

PMTCT STraTegiC ViSion 2010–2015: Preventing mother-to-child transmission of HIV to reach the UNGASS and Millennium Development Goals docx

... mother-to-child transmission of HIV to reach the UNGASS and Millennium Development Goals MOVING TOWARDS THE ELIMINATION OF PAEDIATRIC HIV 18 PMTCT STRATEGIC VISION 2010–2015: PREVENTING MOTHER-TO-CHILD ... presentation of the material in this publication do not imply the expression of any opinion whatsoever on the part of the World Health Organization concerning...

Ngày tải lên: 14/03/2014, 09:20

40 305 0
Tài liệu Children And The Millennium Development Goals pdf

Tài liệu Children And The Millennium Development Goals pdf

... children but also of adults. For children and by children The world’s governments set themselves ambitious targets with the Millennium Development Goals and the Plan of Action of A World Fit for ... child traffi cking. Another major example of global partnerships at work is among the member countries of the Organization of the Islamic Conference (OIC). In 2005...

Ngày tải lên: 12/02/2014, 12:20

100 398 0
SOMALI NUTRITION STRATEGY 2011 – 2013: Towards the Millennium Development Goals pdf

SOMALI NUTRITION STRATEGY 2011 – 2013: Towards the Millennium Development Goals pdf

... to the scale of the humanitarian situation in Somalia and the alarmingly high rates of acute malnutrition, the vast majority of the nutrition interventions are focussed on the management of ... 2013 Towards the Millennium Development Goals The goal, outcomes, outputs and activities of the strategy have been identied using a logical framework approach. The...

Ngày tải lên: 16/03/2014, 05:20

79 343 0
The UN Model Double Taxation Convention in the context of Financing for Sustainable Development

The UN Model Double Taxation Convention in the context of Financing for Sustainable Development

... Country Taxing Rights Taxing Rights Taxing Rights Taxing Rights Objectives of the 2011 Update • Take into account recent developments in the area of international tax policies of both developing and developed countries. • Seek further consistency with the OECD ... twice (i.e. both in the host country of the investment and in the residence country of the investor), by...

Ngày tải lên: 05/09/2013, 14:19

14 489 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... Delta ILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHLARDFGYTCETE :** ** * ** * ** * .** * :*: : :** ** * ** * ** * * :** ** * ** * ** * * :** ** * * .* ** : * Alpha FPAKAVAEFLNRQHSD-PNEQVTRKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEP Beta ... LSLAKDS-LVGGITNPGEVFCSVPGRLSLLSSTSKYKVTVGEVQRRLSPPECLNASLLGG Delta GTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLGG *. :...

Ngày tải lên: 16/02/2014, 09:20

9 642 0
Báo cáo khoa học: Neural retina leucine-zipper regulates the expression of Ppp2r5c, the regulatory subunit of protein phosphatase 2A, in photoreceptor development pdf

Báo cáo khoa học: Neural retina leucine-zipper regulates the expression of Ppp2r5c, the regulatory subunit of protein phosphatase 2A, in photoreceptor development pdf

... increase 1 0 1 0 Mock Mock Flag-Nrl Flag-Nrl Ppp2r5c 1.2 1.2 Rhodopsin ** * ** * 0.4 0.6 0.8 1.0 0.4 0.6 0.8 1.0 Fold increase Fold increase 0.2 0 0.2 0 Mock Mock Ppp2r5c 10 12 Rhodopsin ** * 4 6 8 10 ** ** * ** * Fold increase 2 0 Mock Mock Flag–Nrl ... promoter 25 Luciferase NRE : WT Luciferase : ΔNRE Luciferase NRE : NRE –87 –800 –74 –260 ** ** * 5 10 15...

Ngày tải lên: 06/03/2014, 02:20

10 378 0
MEED S.A. The Costs of Water Pollution in India potx

MEED S.A. The Costs of Water Pollution in India potx

... Murty 2000) The First phase of the Ganga Action Plan has led to other sub-action plans : the Yamuna, Gomati, and Damodar Action Plans, as well as the second phase of the GAP. The National ... for the different costs, which have the merit of giving a confidence index in the precision of the figures. Concerning water pollution, one should notice than the only...

Ngày tải lên: 06/03/2014, 15:21

55 934 0
Revealing the costs of air pollution from industrial facilities in Europe pot

Revealing the costs of air pollution from industrial facilities in Europe pot

... damage costs. A small number of individual facilities cause the majority of the damage costs. Fifty per cent of the total damage cost occurs as a result of emissions from just 191 (or 2 %) of the ... shows the geographical distribution of these 191 facilities. Three quarters of the total damage costs are caused by the emissions of 622 facilities, which...

Ngày tải lên: 06/03/2014, 16:20

74 996 0
w