0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

... Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis Eri Kodama1, Tadashi Baba2, Nobuhisa Kohno2, Sayaka Satoh2, Hideyoshi ... fertilization experiments are more a ccessible thanthose in mammals, and large amounts of s perm and egg areobtainable from thousands of these animals which arecultivated in Onagawa Bay for human ... [17].Homology between ascidian spermosin and humanacrosin, and that between ascidian spermosin and ascidian acrosin were 27% in both cases. In contrast with acrosin,spermosin did not have a consensus...
  • 7
  • 493
  • 0
Tài liệu Báo cáo khoa học: Interferon-a induces sensitization of cells to inhibition of protein synthesis by tumour necrosis factor-related apoptosis-inducing ligand ppt

Tài liệu Báo cáo khoa học: Interferon-a induces sensitization of cells to inhibition of protein synthesis by tumour necrosis factor-related apoptosis-inducing ligand ppt

... Shigeno M, Nako K, Ichikawa T, Suzuki K, Kawakami A, Abiru S, Miyazoe S, Nakagawa Y, Ishikawa H,Hamasaki K et al. (2003) Interferon -a sensitizes humanhepatoma cells to TRAIL-induced apoptosis ... 40760–40767.34 Yamada H, Tada-Oikawa S, Uchida A & Kawanishi S(1999) TRAIL causes cleavage of bid by caspase-8 and loss of mitochondrial membrane potential resulting inapoptosis in BJAB cells. ... Monoclonal antibody against PARP (C2-10)was obtained from Trevigen (Gaithersburg, MD, USA).Antibodies against 4E-BP1 and a- tubulin were obtained from Santa Cruz Biotechnology (Santa Cruz, CA, USA)and...
  • 11
  • 679
  • 0
Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc

Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc

... unlike b-adrenergic and ACTH receptorsthat contain seven transmembrane spanning domains,the ANP receptor (NPR -A) is a guanyl cyclase thatcontains only a single transmembrane spanningdomain [27].We ... Body weight and food intakeof animals housed in pairs were measureddaily at 09.00, i.e. immediately after the darkcycle. (C) and (D) show the average weightgain ± SEM and the average food consump-tion ... accumulation offat mass remains to be determined.Available epidemiological data addressing the impli-cation of PAH, in general, as a causal factor in thepathogeny of metabolic disorders are currently...
  • 11
  • 424
  • 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... RRHEDLLHGP-HA Beta HPWGQRQRQEVGSEAGSLLPQPRAALPQLSG-LDP RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG ... was shownthat the broad-complex, tramtrack and bric -a- bracdomain containing protein KCTD1 directly binds toAP- 2a and acts as a negative regulator for AP- 2a trans-activation [34]. It was also ... Analyses ofAP- 2a- null mice have demonstrated that AP- 2a is a fundamental regulator of mammalian craniofacialdevelopment. AP- 2a knockout mice die perinatallywith craniofacial defects, thoracoabdominoschisis,...
  • 9
  • 642
  • 0
Tài liệu Báo cáo khoa học: Multidentate pyridinones inhibit the metabolism of nontransferrin-bound iron by hepatocytes and hepatoma cells docx

Tài liệu Báo cáo khoa học: Multidentate pyridinones inhibit the metabolism of nontransferrin-bound iron by hepatocytes and hepatoma cells docx

... and novel tetradentate and hexadentate analogues on NTBI uptake and mobilization from rat hepatocytes and hepatoma cells. DFO wasincluded as a reference chelator.Materials and methodsAnimalsHepatocytes ... methylamine was from BDH Chemicals,Australia. All other chemicals were of analytical reagentquality and purchased from Sigma or Ajax (Sydney,Australia).ChelatorsDFO was purchased from Sigma ... Acta 1269, 105–114.38. Agarwal, M.B., Gupte, S.S., Viswanathan, C., Vasandani, D.,Ramanathan, J., Desai, N., Puniyani, R.R. & Chablani, A. T.(1992) Long-term assessment of efficacy and safety...
  • 10
  • 545
  • 0
Báo cáo khoa học: Plant oxylipins: role of jasmonic acid during programmed cell death, defence and leaf senescence doc

Báo cáo khoa học: Plant oxylipins: role of jasmonic acid during programmed cell death, defence and leaf senescence doc

... GENEVESTIGATOR. Arabidop-sis microarray database and analysis toolbox. PlantPhysiol 136, 2621–2632.165 Tsuchiya T, Ohta H, Okawa K, Iwamatsu A, Shi-mada H, Masuda T & Takamiya K-I (1999) ... contributes to OPDA and JA synthesis [34]. Bycontrast, fractions of the unsaturated membrane fattyacid a- linolenic acid and a- linoleic acid are convertedrandomly and nonenzymatically to a variety of ... kinases, calledSARK and SIRK, respectively [125]. SARK and SIRKshare similar structures and consist of an extracellularleucine-rich domain, a transmembrane domain, and a Ser ⁄ Thr kinase domain....
  • 16
  • 488
  • 0
Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx

Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx

... native and the G72 3A and G72 6A sequence variants of BcBL2 indicate that theeffects on affinity observed previously for nativeBsBL2 and its structural variants [2] are valid, at leastqualitatively. ... His-tagged PyrR and a partial specific volumeof 0.7450 cm3Æg)1was calculated from the sequence ofthe native protein; an approximate value for RNA(0.51 cm3Æg)1) was obtained from Table ... velocity analysis of native and His-tagged PyrR.Table S4. Sedimentation velocity constants from thetitration of BcBL2 with PyrR.This material is available as part of the online article from http://www.blackwell-synergy.comPlease...
  • 16
  • 309
  • 0
Báo cáo khoa học: Mycobacterium tuberculosis H37Rv ESAT-6–CFP-10 complex formation confers thermodynamic and biochemical stability docx

Báo cáo khoa học: Mycobacterium tuberculosis H37Rv ESAT-6–CFP-10 complex formation confers thermodynamic and biochemical stability docx

... hairpin conformation and areorientated antiparallel to each other. The contact sur-face between ESAT-6 and CFP-10 is primarily hydro-phobic, and van der Waals interactions betweenESAT-6 and ... endonucleases, T4 DNAligase and DNA size markers were from New England Bio-labs (Beverly, MA, USA). Taq polymerase and other rea-gents for PCR, and the Plasmid Miniprep kit, theMaxiprep kit and ... Bal1, Kandala V. R. Chary2 and Ashish Arora11 Molecular and Structural Biology, Central Drug Research Institute, Lucknow, India2 Department of Chemical Science, Tata Institute of Fundamental...
  • 18
  • 431
  • 0
Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf

Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf

... Tsubouchi H, Naka D, Takahashi K,Okigaki M, Arakaki N, Nakayama H, Hirono S, Sakiy-ama O, Takahashi K et al. (1989) Molecular cloning and sequence analysis of cDNA for human hepatocytegrowth factor. ... Yokohama, Japan2 Advanced Medical Research Laboratory, Mitsubishi Tanabe Pharma Corporation, Kamoshida-cho, Aoba-ku, Yokohama, JapanIntroductionType II transmembrane serine proteases (TTSPs) arestructurally ... sets: 5¢-TCCCATCTGTAGCAGCAACT-3¢ and 5 ¢-GGATTTTCTGAATCGCACCT-3¢ forTMPRSS13 (34 cycles), and 5¢-ATGGAGGCTGCTTGGGCAACA-3¢ and 5¢-ACAGGCAGCCTCGTCGGAGG-3¢for HAI-1 (26 cycles). The GAPDH-specific...
  • 13
  • 641
  • 0
Báo cáo khoa học: Macrocypins, a family of cysteine protease inhibitors from the basidiomycete Macrolepiota procera pot

Báo cáo khoa học: Macrocypins, a family of cysteine protease inhibitors from the basidiomycete Macrolepiota procera pot

... cysteine proteasespapain, cathepsin L and cathepsin V using benzyloxycar-bonyl (Z)-Phe-Arg-7-amido-4-methylcoumarin (AMC) assubstrate, and for legumain with Z-Ala-Ala-Asn-AMC asthe substrate, ... Supplementary Data in Doc. S1 and Doc. S2 and Fig. S1 and S2).Cloning and analysis of macrocypin cDNA and gene sequencesThe N-terminal sequence (H2N-GLEDGLYTIRHLVEGQPPNIPGGMYASSKDGKDXPVTAEPPLP) and the ... for analysing proteolyticmechanisms and protein protein interactions, and asbiocidal agents against various organisms. There areseveral groups of inhibitors, mainly from animal and plant origins,...
  • 12
  • 368
  • 0

Xem thêm

Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họcMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP