Báo cáo khoa học: Sequences and structural organization of phospholipase A2 genes from Vipera aspis aspis, V aspis zinnikeri and Vipera berus berus venom Identification of the origin of a new viper population based on ammodytin I1 heterogeneity docx
Báo cáo khoa học: Sequences and structural organization of phospholipase A2 genes from Vipera aspis aspis, V. aspis zinnikeri and Vipera berus berus venom Identification of the origin of a new viper population based on ammodytin I1 heterogeneity docx
... et al.(Eur. J. Biochem. 270) Ó FEBS 2003 Sequences and structural organization of phospholipase A 2 genes from Vipera aspis aspis , V. aspis zinnikeri and Vipera berus berus venom Identification ... of acquiring new functions [9,11]. In this paper, we extend the study of PLA2 genes to the French vipers Vipera aspis aspis (V. a. aspis) , V...
Ngày tải lên: 17/03/2014, 03:20
Báo cáo khoa học: Photosynthetic acclimation: Structural reorganisation of light harvesting antenna – role of redox-dependent phosphorylation of major and minor chlorophyll a/b binding proteins pot
... plants, depending on the light conditions and the species anal- ysed [12]. Environmental conditions can fluctuate on a time- scale of seconds, days and months. Photosynthetic organisms have evolved a number of ... differ between the aquatic unicellular green alga Chlamydo- monas reinhardtii and land plants. In particular, the greater extent of state transitions in C...
Ngày tải lên: 16/03/2014, 06:20
Báo cáo khoa học: PRDM1/Blimp1 downregulates expression of germinal center genes LMO2 and HGAL pot
... 5¢-TGGATCAATCTCAAATGCATT ACACTACGAGCACGCGACCAGACTTAAAGCCTACC TTCTGTG-3¢ and for HGAL-mutant#2: 5¢-TATAAA AATTTGTACACACAGTCTTAGAGGACATACGTGTG TCGTGGCTAAATGCCTAGGAGTGAAATTGC-3¢ and 5¢-GCAATTTCACTCCTA ... (Stratagene, La Jolla, CA, USA). Primers used for mutagenesis with mutations in lower case are HGAL-mutant#1: 5¢-CACAGAAGGTAGGCTTTAAG TCTGGTCGCGTGCT CGTAG TG TAATG CATTTG AGA TTGATCCA-3¢ a...
Ngày tải lên: 05/03/2014, 23:20
Báo cáo khoa học: Distinguishing between different pathways of bilayer disruption by the related antimicrobial peptides cecropin B, B1 and B3 pptx
... 35-amino-acid peptide amides CB ( H) KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGE AKAL )CONH 2 ), CB1 ( H) KWKVFKKIEKMGRNIRNGI VKAGPKWKVFKKIEK )CONH 2 )andCB3( H) AIAVLGE AKALMGRNIRNGIVKAGPAIAVLGEAKAL )CONH 2 ) used ... bacteria, the production of cationic antimicrobial peptides is probably a survival strategy to obtain an ecological advantage over competitors [8–10]. In invertebrates and plants,...
Ngày tải lên: 08/03/2014, 08:20
Báo cáo khoa học: The noncatalytic C-terminus of AtPOLK Y-family DNA polymerase affects synthesis fidelity, mismatch extension and translesion replication ppt
... AtPOLK Y-family DNA polymerase affects synthesis fidelity, mismatch extension and translesion replication Marı ´ a Victoria Garcı ´ a- Ortiz, Teresa Rolda ´ n-Arjona and Rafael R. Ariza Departamento ... a function of the dNTP concentration and the data were fitted to the Michaelis–Menten equation. The apparent K m and V max steady state kinetic parameters for the inco...
Ngày tải lên: 16/03/2014, 10:20
Báo cáo khoa học: Cytokinin-induced structural adaptability of a Lupinus luteus PR-10 protein potx
... difference was assumed to be a manifestation of the adaptability of the PR-10 fold to the presence of the hormone ligands [25]. As a consequence of the straightening of the a3 -helix, the cavity of LlPR-10.2B ... model of the LlPR-10.2B protein has good overall geometry and Ramachandran statistics (Table 1). The quality of the electron density maps i...
Ngày tải lên: 23/03/2014, 06:20
Báo cáo khoa học: Solubility-dependent structural formation of a 25-residue, natively unfolded protein, induced by addition of a seven-residue peptide fragment pot
... the values measured by Wolfenden et al. [16]. Those of Pro and Arg side chains and the backbone are taken from the values measured by Privalov et al. [17]. pK values of the amino acid side chains, a- COOH ... calculated using the hydration poten- tials of the amino acid side chains and the backbone [16,17]. In addition, because the individual hydration potential...
Ngày tải lên: 29/03/2014, 23:20
Báo cáo khoa học: Stage-specific expression of Caenorhabditis elegans ribonuclease H1 enzymes with different substrate specificities and bivalent cation requirements ppt
... 10111213141516 A 5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3' 5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3' 5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3' 5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3' Ce-RNH1α, ... gene. rnh-1.0α rnh-1.0β α β A UGAAAAUUUAGGAGUCAAACGUUGUUUUAGAUUCAAGAAA αβ B Fig. 3. Alternative splicing of rnh-1. 0a and rnh-1.0b. (A) Schematic presentation of alt...
Ngày tải lên: 30/03/2014, 11:20
Báo cáo khoa học: In vivo cross-linking of nucleosomal histones catalyzed by nuclear transglutaminase in starfish sperm and its induction by egg jelly triggering the acrosome reaction pdf
... (A 260 )]. The reaction was stopped by the addition of EDTA to a final concentration of 5 m M and then cooled on ice. The S1 fraction was obtained as the supernatant by centrifugation of the reaction ... the charge and conformation of the molecules [1]. The majority of these modifications occur at the N-terminal region of the core histones and possibly...
Ngày tải lên: 31/03/2014, 07:20
Báo cáo khoa học: Genome-wide identification of glucosinolate synthesis genes in Brassica rapa potx
... will allow for the easy identification of relevant genes in Brassicas. The identification and characteriza- tion of glucosinolate synthesis genes in Chinese cab- bage would pave the way for further ... procedures Construction of the cDNA and BAC libraries B. rapa cultivar ‘Chiifu’ was used for library construction based on the agreement of the Multinational B...
Ngày tải lên: 29/03/2014, 23:20