Báo cáo khoa học: A novel retinol-binding protein in the retina of the swallowtail butterfly, Papilio xuthus docx
Báo cáo khoa học: A mouse model for in vivo tracking of the major dust mite allergen Der p 2 after inhalation docx
... (the 16 kDa band) that the clearance and further metabo- lism of the allergen was altered as a result of the in ammation in the lungs of sensitized animals. Up to now there are few data available ... residue in a C-terminal Sel-tag [18]. Der p 2 carrying the Sel-tag had an intact core sequence and maintained allergen-specific IgE-binding epitopes and the use of a...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: A novel plant protein disulfide isomerase family homologous to animal P5 – molecular cloning and characterization as a functional protein for folding of soybean seed-storage proteins docx
... Putative cis-acting element involved in unfolded protein response ))117 CCAAT CCAAT-catatattt-aCACG )300CORE TGTAAAG found in upstream of the promoter from the B-hordein gene of barley and the alpha-gliadin, gamma-gliadin, ... synthesis of glycinin was initi- ated when the seeds achieved a mass of 50 mg and increased gradually until they grew to 300 mg. We also demonst...
Ngày tải lên: 30/03/2014, 04:20
Báo cáo khoa học: A novel phosphorylated glycoprotein in the shell matrix of the oyster Crassostrea nippona pptx
... oyster Crassostrea nippona Tetsuro Samata, Daisuke Ikeda, Aya Kajikawa, Hideyoshi Sato, Chihiro Nogawa, Daishi Yamada, Ryo Yamazaki and Takahiro Akiyama Laboratory of Cell Biology, Faculty of Environmental ... lane A, CBB staining; lane B, Stains-all staining; lane C, negative staining; lane D, Methyl green staining. Arrows on the right side of the lanes indicate the position of...
Ngày tải lên: 30/03/2014, 04:20
Báo cáo khoa học: A novel retinol-binding protein in the retina of the swallowtail butterfly, Papilio xuthus docx
... 2003 Retinol-binding protein in butterfly eye (Eur. J. Biochem. 270) 2445 A novel retinol-binding protein in the retina of the swallowtail butterfly, Papilio xuthus Motohiro Wakakuwa 1 , Kentaro Arikawa 1 and ... environment of plasma and cytoplasm, and allow regeneration of visual pigments. Here, we identified a novel retinol-binding protein in the...
Ngày tải lên: 17/03/2014, 03:20
Báo cáo khoa học: A novel four transmembrane spanning protein, CLP24 A hypoxically regulated cell junction protein pdf
... * Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacag cctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcag aggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgt gtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaac ctcgttctgcctccagctttcctggttagcgcaacgcggctccacgacca cacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgc gaggctgccctgcgctccgctttgctttgggattaatttattctgcatct gctgagaggggcaccccagccatatcttacactttg...
Ngày tải lên: 30/03/2014, 14:20
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 276 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig. 1. (A) Diagram of human PPP1R3E mRNA compared ... RGRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQI MOUSE R3E 119 QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQ...
Ngày tải lên: 30/03/2014, 16:20
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAY...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... the basis of a comparative analysis of the involvement of wild-type occludin (Occ WT ) and variant occludin in apoptosis and invasion, as determined by ass...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... into tachykinin-related peptides, their receptors, and invertebrate tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Min...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size and shape of the substrates, and second, incorporation of an imido-group increases the stability of transition state...
Ngày tải lên: 19/02/2014, 02:20