Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

... CYP17 5A1 is used as an inter- mediate for the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMG...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... Relative fluorescence intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the...

Ngày tải lên: 18/02/2014, 18:20

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide Atsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo Satake Suntory Institute for Bioorganic Research, Osaka, Japan Tachykinins ... Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the com...

Ngày tải lên: 19/02/2014, 00:20

... selenium- containing GPX mimics. We also studied the catalytic mechanism using steady-state kinetics of 6-CySeCD catalysis and investigated the antioxidant ability of 6-CySeCD using a mitochondria injury ... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beiji...

Ngày tải lên: 19/02/2014, 02:20

... Thomas-Oates, J.E. & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... which links the O-7 of a Hep residue, and a 2-amino-2-deoxy galactose (GalN), which is the branching point of the oligosaccharide. The amino function of the GalN res...

Ngày tải lên: 19/02/2014, 13:20

... significant levels of identity to sequences of 2-aminomuconate deaminases [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, ... the determination of released ammonia. The coupled enzyme assay revealed the mechanism of the deamination reaction and the subsequent metabolism, including the deaminat...

Ngày tải lên: 19/02/2014, 16:20

... to clone the MABO gene. The DNA fragment carrying the MABO ORF was amplified with the primer pair 5¢-GAC CTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear- ing the restriction ... role in the biodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in...

Ngày tải lên: 19/02/2014, 16:20

... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... classifiers and the remaining to evaluate results. The aim of the first set of experiments is to examine the role of structure features. In these experiments, a...

Ngày tải lên: 20/02/2014, 09:20

... 17 base pairs. The schematic structure of each substrate is shown on the left side of the autoradiogram of the gel. The percentage unwinding is shown on the topofeachpanel.Ineachpanel,lane1isthereactionwithout enzyme, ... VI) showed a linear rate up to 30 min (Fig. 4A) . After further incubation it deviated from the linearity and became saturated at  60 min. Titrati...

Ngày tải lên: 20/02/2014, 11:20

... represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TA CAT-3¢, corresponding to amino-acid sequences RMRTVTNYF (at transmembrane domain II of mamma- lian tachykinin receptors) and ... TTTTGTgtaaat)146 bpÀcaacagGTATAA Intron 3 AGACGGgtatga)469 bpÀtttcagGTAGTG Intron 4 TGCCAGgtatgt)119 bpÀttccagATTCCG Fig. 5. Schematic representation of the UTKR cDNA and intron...

Ngày tải lên: 21/02/2014, 03:20