Báo cáo khoa học: A novel serine protease highly expressed in the pancreas is expressed in various kinds of cancer cells potx

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... CYP17 5A1 is used as an inter-mediate for the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... maximal activity at pH 4.5–6.5. The thermostability of the FNR was evaluated bymeasuring the residual ferricyanide reduction activityafter incubation of the FNR for 30 min at various temperatures...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activity Cells ... Relativeﬂuorescence intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation ... was analyzed using a Matrigel assay. The number of invasive cells was determined by counting stained cells and thennormalizing to the number in the case of control shRNA-transfected cells. All...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... selenium-containing GPX mimics. We also studied the catalyticmechanism using steady-state kinetics of 6-CySeCDcatalysis and investigated the antioxidant ability of 6-CySeCD using a mitochondria injury ... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size andshape of the substrates, and second, incorporation of an imido-group increases the stability of transitionstate selenolate in the catalytic...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... which links the O-7 of a Hep residue, and a 2-amino-2-deoxy galactose (GalN), which is the branchingpoint of the oligosaccharide. The amino function of the GalNresidue is frequently acylated ... KOH. The lipo-oligosaccharide was also analyzed after acid treatment,attained by mild hydrolysis with acetic acid, to obtaininformation on the nature of the phosphate and acyl groups. The two...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... signiﬁcant levels of identity tosequences of 2-aminomuconate deaminases [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, ... the determination of released ammonia. The coupled enzymeassay revealed the mechanism of the deamination reactionand the subsequent metabolism, including the deaminationstep. The product formed from 4-amino-3-hydroxybenzoicacid ... and2-aminomuconic acid in the modiﬁed meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been puriﬁed andcharacterized in detail [5,6]. The nucleotide...

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... to clone the MABO gene. The DNA fragment carrying the MABOORF was ampliﬁed with the primer pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction ... role in the biodegradation of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway ... o-dianisidine (Sigma) and 10 lgÆmL)1 of MABO. The reaction was initiated by the addition of substrate, and the increase in absorption at 430 nm caused by the oxidation of o-dianisidine was followed...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... classifiers and the remaining to evaluate results. The aim of the first set of experiments is to examine the role of structure features. In these experiments, a “NONE” class is added to indicate ... both internal and external context. Internal context includes the characters inside two entities and the characters inside the heads of two entities. External context involves the characters around...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... 17 base pairs. The schematic structure of each substrate is shown on the left side of the autoradiogram of the gel. The percentage unwinding is shown on the topofeachpanel.Ineachpanel,lane1isthereactionwithoutenzyme, ... VI)showed a linear rate up to 30 min (Fig. 4A) . After furtherincubation it deviated from the linearity and becamesaturated at  60 min. Titration of helicase activity withincreasing amounts of the ... [22]. Daunorubicin intercalates into the major groove of DNA while nogalamycin intercalatesinto both major and minor grooves of DNA. Ethidiumbromide, a potent inhibitor of DNA synthesis, is a phenathridium...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... represents an inosine residue)and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TACAT-3¢, corresponding to amino-acid sequencesRMRTVTNYF (at transmembrane domain II of mamma-lian tachykinin receptors) and ... TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 bpÀttccagATTCCGFig. 5. Schematic representation of the UTKRcDNA and intron/exon organization of ... doseÀresponse data and the EC50 values of the experiment wereanalyzed usingORIGIN6.1 software (Microcal SoftwareInc.).RESULTSCloning of a Uru-TK receptor cDNAComparative analysis of amino-acid sequences...

Xem thêm