Báo cáo khoa học: A novel hyperthermostable 5¢-deoxy-5¢-meth

Báo cáo khoa học: A novel hyperthermostable 5¢-deoxy-5¢-methylthioadenosine phosphorylase from the archaeon Sulfolobus solfataricus pdf

... replaced Cys259 and Cys261 with Ser and the primers 5¢-GGTCGTGTTCCTGT AGCAACAGTCTG AAGACAG-3¢ (sense) and 5¢-CTGTCTTCAGACTGTT GCTACAGGAACACGACC-3¢ (antisense) were used to make one silent mutation ... Rosa M, Gambacorta A, Bertoldo C & Zappia V (1991) S-Adenosylmethionine decarboxylase from the thermophilic archaebacterium Sulfolobus solfataricus: puriﬁcation, molecular propert...

Ngày tải lên : 16/03/2014, 18:20

14
313
0

Báo cáo khoa học: A novel factor XI missense mutation (Val371Ile) in the activation loop is responsible for a case of mild type II factor XI deﬁciency doc

... FXI-deficient plasma as sub- strate (Hemoliance, Salt Lake City, UT). FXI antigen was measured by an ELISA based on a goat anti-human FXI affinity purified IgG as capture antibody and a goat anti- human FXI ... can activate FXI, i.e. activated factor XII (FXIIa), FXIa, and thrombin, the main physiologic activator is actually thrombin formed on the surface of activated platelets [6–8]. Cl...

Ngày tải lên : 23/03/2014, 07:20

11
563
0

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... same as above. An auto- radiogram showing helicase activity of the active fractions is shown on the left side of the graph. In both the gels (A and B) the control and the boiled lanes are reactions ... 2A, lane 4) and ssDNA-dependent ATPase activity (data not shown) sedimented together between alcohol dehydrogenase and BSA (fraction 11) and gave a molecular mass of 120 kDa with...

Ngày tải lên : 20/02/2014, 11:20

11
573
0

Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"

... 5’-AAGGAGGCACTGGGAGAGGGGAAAT-3’ (bases -1323 to -1299) and antisense, 5’- CCCCACCAAGCCAACACAGGATGGA -3’ (bases -919 to-895) were used to amplify a 429-bp product from genomic DNA (Fig. 1A) . The PCR ... Y. Watanabe and Dr. Y. Izumi for collecting the samples, and Ms. H. Tobe, M. Nakamura, and K. Sugama for their technical as- sistance. This work was supported financially by a...

Ngày tải lên : 26/10/2012, 10:04

7
612
1

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano...

Ngày tải lên : 18/02/2014, 08:20

14
617
0

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay...

Ngày tải lên : 18/02/2014, 18:20

12
613
0

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors, and invertebrate tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Min...

Ngày tải lên : 19/02/2014, 00:20

11
595
0

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was purchased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... such as instability, antigenicity and poor availability, much attention has been paid to its artiﬁcial imitation [9,10]. In synthetic approaches, an initial attempt is made to synthesize...

Ngày tải lên : 19/02/2014, 02:20

9
491
0

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, and endowed with unusual metabolic capabilities for the degradation of aromatic hydrocarbons ... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Es...

Ngày tải lên : 19/02/2014, 13:20

14
715
0

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was ... and 2-aminomuconic acid in the modified meta-cleavage pathway (Fig. 1B). The 2-aminomuconate deaminase from s train AP-3 and that from strain JS45 have been purified and characterized i...

Ngày tải lên : 19/02/2014, 16:20

7
613
1