Báo cáo khoa học: The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate group docx

... Journal compilation ª 2006 FEBS 3989 The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate ... Sciences, National Research Council of Canada, Ottawa Ontario, Canada Campylobacter jejuni is one of the leading causes of human gastroen...

Ngày tải lên: 16/03/2014, 13:20

... domain and the functional relationship of tandemly repeated domains in BPPs. We conjecture that dual-domain BPPs have succeeded evolutionarily because they can increase the amount of available ... was determined using the Bradford assay with BSA as the standard [28]. Phytase activity assay Phytase activity was determined by measuring the amount of phosphate released from I...

Ngày tải lên: 14/02/2014, 15:20

... damage of chloroplastic A 4 -GAPDH. Results Inactivation of A 4 -GAPDH by GSSG and other oxidants, and protection by substrate and cofactors Incubation of recombinant Arabidopsis A 4 -GAPDH with ... Arabidopsis A 4 -GAPDH The sequence encoding the putative mature form of the A. thaliana plastidial A 4 -GAPDH isoform (GapA-1 cDNA At3g26650 provided by TAIR, Sta...

Ngày tải lên: 19/02/2014, 05:20

... hexameric state (U 6 ) and monomeric state (6 U). Figure 4A shows that the native form of Hfq has an apparent molecular mass of 50 ± 10 kDa, while the unfolded state of Hfq has an average apparent ... between Proteobacteria, Firmicutes, Thermotogales and Aquificales. On the contrary, the C-terminal fragments are variable in length and amino acid composition. The posi...

Ngày tải lên: 19/02/2014, 12:20

... grapheme-phoneme mappings and hence, that they are more consistent with a parallel distributed approach than with the abstract rules hypothesis. . Statistical analysis of grapho- phonological correspondences ... impose a substantial restatement of the theory, because it violates the core assumption of the approach, namely, that language users induce all- or-n...

Ngày tải lên: 20/02/2014, 19:20

... comprise Cytc_Ddes Cytc_Dgig NrfH_Wsuc NrfH_Sdel NrfH_Ddes CymA_Sput NapC_Rsph NapC_Ppan NapC_Abra NapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... nature (Fig. 1, lane 1). However, in the absence of boiling (Fig. 1A, lanes 2 and 4) high molec...

Ngày tải lên: 21/02/2014, 00:20

... a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ere ... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e...

Ngày tải lên: 21/02/2014, 20:20

... The actual DNA synthesis is performed by the catalytic a- subunit (PolIIIa), which belongs to the C-family of DNA polymerases [2]. Polymerases of the C-family fall into two major groups, DnaE and ... DNA replication at the elongation step, including the different interactions that coordinate leading and lagging strand synthesis. Although bacterial DNA replication has be...

Ngày tải lên: 05/03/2014, 23:20

... Fluka (Buchs, Switzerland). All other chemicals were of analytical reagent grade and were Sigma or Fluka products. Preparation of the OA complexes of a- LA fragments The a- LA fragments investigated, ... was shown that the fragments acquire an enhanced content of a- helical secondary structure upon binding OA. The physical and aggregation state of OA at physiological...

Ngày tải lên: 06/03/2014, 09:22

... pF 6a- HIS3MX6 GGCAATTGGAGTGACATAGCAGCTACTACAACTACAAAAGCAAAATCTCCACAAAGTAAT CGGATCCCCGGGTTAATTAA R13 TUB2 deletion pF 6a- HIS3MX6 CCAAGTGCTTCAATCCTAGAGAAGAAGAAAGGTAAGAAAAAGAAAGGAAAGCAACTTAAT GAATTCGAGCTCGTTTAAAC Resistance ... tag pFA 6a- 13Myc-HIS3MX6 CAAATGGGAAGTTGTTGGTAGAGAAGTCATCTCTCGATCAGAATTCGAGCTCGTTTAAAC F3 PPH21 N-terminal 3HA tag pMPY-3xHA CATAGTGGAAAGAGGGATATAAATTATCGCATAAAACAATAAA...

Ngày tải lên: 07/03/2014, 12:20