Báo cáo khoa học: A di-leucine sorting signal in ZIP1 (SLC39A1) mediates endocytosis of the protein doc

Báo cáo khoa học: A di-leucine sorting signal in ZIP1 (SLC39A1) mediates endocytosis of the protein doc

Báo cáo khoa học: A di-leucine sorting signal in ZIP1 (SLC39A1) mediates endocytosis of the protein doc

... Golgi location to the cell surface, indicating that the signal for the plasma membrane targeting of ZIP1 is distin- guished from the signal for plasma membrane retrieval and protein degradation. The signal( s) ... suggests that the ETRALL 144)149 sorting signal of ZIP1 may also play a role in signaling of the protein for degradation. To confirm the in...

Ngày tải lên: 16/03/2014, 11:20

12 374 0
Báo cáo khoa học: "A DOM Tree Alignment Model for Mining Parallel Data from the Web" doc

Báo cáo khoa học: "A DOM Tree Alignment Model for Mining Parallel Data from the Web" doc

... the absolute value of mining sys- tem recall is hard to estimate because it is im- practical to evaluate all the parallel data held by a bilingual website. Instead, we compare mining coverage ... discovered are regarded as anchors to new parallel data. This makes the mining scheme an iterative process. The new mining scheme has three advantages: (i) Mining coverage is increase...

Ngày tải lên: 08/03/2014, 02:21

8 435 0
Báo cáo khoa học: "A Hierarchical Pitman-Yor Process HMM for Unsupervised Part of Speech Induction" doc

Báo cáo khoa học: "A Hierarchical Pitman-Yor Process HMM for Unsupervised Part of Speech Induction" doc

... 47th Annual Meet- ing of the Association for Computational Linguistics and the 4th International Joint Conference on Natu- ral Language Processing of the Asian Federation of Natural Language Processing ... Processing (ACL-IJCNLP), pages 504–512. Noah A. Smith and Jason Eisner. 2005. Contrastive estimation: Training log-linear models on unlabeled data. In Proceedings of the...

Ngày tải lên: 17/03/2014, 00:20

10 422 0
Báo cáo khoa học: A new paradigm for oxygen binding involving two types of ab contacts docx

Báo cáo khoa học: A new paradigm for oxygen binding involving two types of ab contacts docx

... stability of the b chain against the acidic autoxidation. This was the next step to be clarified. Stability property of the separated a and b chains In separated a and b chain solutions, the protein ... HbA. At the a1 b1anda2b2 interfaces, on the other hand, negligible changes are found insofar as the crystal structure has been examined. These are called the pack...

Ngày tải lên: 17/03/2014, 10:20

11 371 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... b-catenin, suggesting that a- defensins activate the b-catenin signaling pathway. We then studied the role of the b-catenin signaling pathway in a- defensin- induced increases in the proliferation ... indicate that a- defensin-induced increases in lung fibroblast proliferation and collagen synthesis involve the b-catenin signaling pathway. Inhibition of b-catenin signali...

Ngày tải lên: 18/02/2014, 06:20

12 602 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax- anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAY...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and 2-aminomuconic acid in the modified meta-cleavage path- way (Fig. 1B). The 2-aminomuconate deaminase from s train AP-3 and that from strain JS45 have been puri...

Ngày tải lên: 19/02/2014, 16:20

7 613 1
Tài liệu Báo cáo khoa học: "A Sentimental Education: Sentiment Analysis Using Subjectivity Summarization Based on Minimum Cuts" doc

Tài liệu Báo cáo khoa học: "A Sentimental Education: Sentiment Analysis Using Subjectivity Summarization Based on Minimum Cuts" doc

... regardless of whether their probabil- line to compare against, we take the canonical sum- marization standard of extracting the first N sen- tences — in general settings, authors often be- gin documents ... be- tween sentences in the same paragraph; on the other hand, it also (probably unavoidably) poses a hard constraint that all of a paragraph’s sentences get the same...

Ngày tải lên: 20/02/2014, 16:20

8 473 0
Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc

Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc

... centrifugation. The final plasma samples used in the determination of GSH were obtained. Determination of GSH in plasma and accuracy assessment by recovery experiments In order to evaluate the applicability ... processes such as transport, protein synthesis, catabolism and metabolism [1]. It can also protect cells against reactive oxygen species and help them maintain an adeq...

Ngày tải lên: 07/03/2014, 05:20

8 429 0
Báo cáo khoa học: A mouse model for in vivo tracking of the major dust mite allergen Der p 2 after inhalation docx

Báo cáo khoa học: A mouse model for in vivo tracking of the major dust mite allergen Der p 2 after inhalation docx

... (the 16 kDa band) that the clearance and further metabo- lism of the allergen was altered as a result of the in ammation in the lungs of sensitized animals. Up to now there are few data available ... residue in a C-terminal Sel-tag [18]. Der p 2 carrying the Sel-tag had an intact core sequence and maintained allergen-specific IgE-binding epitopes and the use of a...

Ngày tải lên: 07/03/2014, 21:20

12 519 0
Từ khóa:
w