Báo cáo khoa học: A novel trehalase from Mycobacterium smegmatis ) purification, properties, requirements potx
... government works A novel trehalase from Mycobacterium smegmatis ) purification, properties, requirements J. David Carroll 1 , Irena Pastuszak 2 , Vineetha K. Edavana 2 , Yuan T. Pan 2 and Alan D. Elbein 2 1 ... arrow b), b-amylase (200 kDa, arrow c), alcohol dehydrogenase (150 kDa, arrow d) and bovine serum albumin (66 kDa, arrow e). Novel trehalase from Mycobacter...
Ngày tải lên: 16/03/2014, 11:20
... primers: Aba, 5¢-ATGGACGCTGAAT TCCGTCACGACTCTGGTTACGAAGTTCACCACCAG AAGCTGGTG-3¢;Abb, 5¢-GTTCACCACCAGAAGCT GGTGTTCTTC GCTGAA GACGT GGGTTCT AACAAG GGTGCT-3¢;Abc, 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab- start, ... 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC-3¢;Ab- start, 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG-3¢;Abstop, 5¢-CCTGCCGAGCTCCTATTA CACAACGCCACCAACC...
Ngày tải lên: 18/02/2014, 13:20
... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- C...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wastewater treatment plant, ... polysaccharide from lipopolysaccharide of Acinetobacter calcoaceticus strain 7 (DNA group 1). Eur. J. Biochem. 243, 167–173. 47. Nikaido, H. & Vaara, M. (198 5) Molecular...
Ngày tải lên: 19/02/2014, 13:20
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx
... 2A, lane 4) and ssDNA-dependent ATPase activity (data not shown) sedimented together between alcohol dehydrogenase and BSA (fraction 1 1) and gave a molecular mass of 120 kDa with a sedimen- tation ... m M ), ammonium sulfate (45 m M ), M13 ssDNA (30 l M as P, phosphate), M13 dsDNA (30 l M as P), pea leaf total RNA (30 l M as P), E. coli t-RNA (30 l M as P) and histone (1 mgÆ...
Ngày tải lên: 20/02/2014, 11:20
Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc
... glutamate dehydrogenase (GDH) (EC 1.4.1. 3) catalyzes the oxidative deamination of L-gluta- mate and various monocarboxylic acid substrates [1]. The enzyme also shows the unique ability, among mammalian ... with the fact that the overall rate of oxidative deamination is very much lower with alternative amino acid sub- strates. GDH from mammalian sources is highly regulated by a diverse...
Ngày tải lên: 05/03/2014, 23:20
Báo cáo khoa học: A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif doc
... CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAG GGAT 1r TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC 2r CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG 3r GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCA Reverse GCTA GGATCCCTAGCAACCACGGCAC Table 2. Antifungal activity ... Odintsova 1 , Alexander A. Vassilevski 2 , Anna A. Slavokhotova 1 , Alexander K. Musolyamov 2 , Ekaterina I. Finkina 2 , Natalia V. Khadeeva 1 , Eugene A. Rogoz...
Ngày tải lên: 07/03/2014, 02:20
Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf
... gamus, Molgula occidentalis and Pyura vittata); 11 species of Cnidaria (Bartholo- mea annulata, Budonosoma granulifera, Cassiopea xamachana, Condylactys gigantea, Gorgonia ventalina, Lebrunia ... Biotecnologia (XeRBa, Generalitat de Catalunya). M .A. C. acknowledges a Visitor Grant from AGAUR (Generalitat de Catalunya). Professor Magnus Abrahamson and colleagues (Lund, Sweden) are acknowl...
Ngày tải lên: 07/03/2014, 02:20
Báo cáo khoa học: Adenylyl cyclase Rv0386 from Mycobacterium tuberculosis H37Rv uses a novel mode for substrate selection ppt
... available structural data of canonical mammalian class IIIa and mycobacterial class IIIc catalytic domains [5,7,9,25] nor do they parallel the findings on the noncanonical class IIIc AC Rv1900c [14]. Another novel ... Rv0386 ( 1)1 7 5) N106D was partic- ularly remarkable, because asparagine can act as both, a hydrogen-bond donor via its amide group and as a hydrogen-bond acceptor vi...
Ngày tải lên: 07/03/2014, 21:20
Báo cáo khoa học: A novel hyperthermostable 5¢-deoxy-5¢-methylthioadenosine phosphorylase from the archaeon Sulfolobus solfataricus pdf
... endonuc- leases and DNA-modifying enzymes were obtained from Takara Bio, Inc. (Otsu, Shiga, Japan). Pfu DNA polymerase was purchased from Stratagene (La Jolla, CA, USA). [methyl- 14 C]AdoMet (50–60 ... replaced Cys259 and Cys261 with Ser and the primers 5¢-GGTCGTGTTCCTGT AGCAACAGTCTG AAGACAG-3¢ (sense) and 5¢-CTGTCTTCAGACTGTT GCTACAGGAACACGACC-3¢ (antisense) were used to make one silent m...
Ngày tải lên: 16/03/2014, 18:20