Báo cáo khoa học: Three-step hydroxylation of vitamin D3 by a genetically engineered CYP105A1 doc

... 43–66. 8 Sasaki J, Miyazaki A, Saito M, Adachi T, Mizoue K, Hanada K & Omura S (1992) Transformation of vita- min D3 to 1 alpha,25-dihydroxyvitamin D3 via 25-hydroxyvitamin D3 using Amycolata sp. ... 7500 E-mail: tsakaki@pu-toyama.ac.jp Database Structural data are available in the Protein Data Bank database under the accession numbers 3CV8 and 3CV9 (Received 14 May 2010, revised...

Ngày tải lên: 15/03/2014, 23:20

... 12 0A PTH analyser. Synthesis of cDNA Total RNA was extracted using the RNeasy Mini Kit (Qiagen) according to the manufacturer’s instructions. It was treated with RNAase-free DNAase I (Pharmacia) ... have approximately the same Table 1. Primer sequences. Primer (5¢fi3¢) Corresponding peptide AS1 GGTTGCCTGAGRTGYATHTG a GCLRCIC AS3 GGGCTATTGGTCAGACGCTACACTC GYWSDATL AS3R GAGTGTAGCGTCTGACCAA...

Ngày tải lên: 19/02/2014, 12:20

... substrate binding and as a catalytic base. To complete the reaction, attack by the lone pair of the glyphosate nitrogen on the carbonyl carbon of CoA-SAc results in a tetrahedral inter- mediate. ... The shikimate pathway that leads to the biosynthesis of aromatic amino acids, and the mode of action of glyphosate on the reaction catalyzed by EPSPS. Mechanisms of glyphosate...

Ngày tải lên: 14/02/2014, 14:20

... to acti- vation of AMPK cannot lead to production of ATP because of lack of mitochondrial ADP. As AMPK sti- mulates cellular fatty acid uptake [29] and the availab- ility of circulating fatty acids ... P 1 ,P 5 -di(adenosine-5¢)-pentaphosphate (Ap 5A) as inhibitor of adenylate kinase to prevent depletion of available ATP and ADP and to maintain steady-state respiration. Instead,...

Ngày tải lên: 19/02/2014, 05:20

... set of met- ric variants at three linguistic levels: lexical, syn- tactic, and semantic. In all cases, translation qual- ity is measured by comparing automatic transla- tions against a set of ... Amig ´ o, Julio Gonzalo, Anselmo Pe nas, and Felisa Verdejo. 2005. QARLA: a Framework for the Evaluation of Automatic Summarization. In Proceedings of the 43rd Annual Meeting of the A...

Ngày tải lên: 20/02/2014, 07:20

... Proceedings of the COLING/ACL 2006 Main Conference Poster Sessions, pages 428–435, Sydney, July 2006. c 2006 Association for Computational Linguistics 428 0.5 1 1.5 ... 4 5 6 7 8 entropy offset 429 430 431 432 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 0.55 0.6 0.65 0.7 0.75 0.8 0.85 0.9 0.95 1 recall precision Bincrease Bordinary Bmax 433 0 0.1 0.2 ... 1 recall precision...

Ngày tải lên: 20/02/2014, 12:20

... initial analysis nave been considered, the process which attempts to find causal connections between conceptualizations is activated, in this particular case, the analyzer has already indicated ... wants to take control of (and ultimately make use of) whatever it is that Is output from that SOURCE. In CD, this is expressed by a template for an ATRANS (abstract tra...

Ngày tải lên: 21/02/2014, 20:20

... Dynamic model-theoretic semantics allows the evaluation of a formula to cause the addition of information to the model. This interaction of the evaluation of a formula and the expansion of ... semantics provides a computationally attractive means of representing the semantics of natural language. However, the models used in this formalism are static and are usually...

Ngày tải lên: 21/02/2014, 20:20

... .58 Table 1: Classification of it by two annotators in a corpus subset. 4 Automatic Classification 4.1 Training and Test Data Generation 4.1.1 Segmentation We extracted all instances of it and the ... shallow feature generation meth- ods could propagate into the model that was learned from the data. The advantage of this ap- proach is, however, that training and test data are homogene...

Ngày tải lên: 22/02/2014, 02:20

... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAG mkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY (1) H. thermoluteolus (2) A. vinosum (3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTA LKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEE VKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK- ARPEIWSDA...

Ngày tải lên: 06/03/2014, 00:20