Báo cáo Y học: Lectin–sugar interaction Calculated versus experimental binding energies ppt

... resulted in more robust energies, especially for the highly flexible ligands N,N¢-diacetylchitobiose and N-acetylneuraminic acid. Binding mode As the binding free energies are highly dependent on the correct ... electrostatic interaction. This results in a calculated binding free energy only slightly lower than that of a-NPhGlcNAc. Binding energies The binding free energies...

Ngày tải lên: 08/03/2014, 16:20

... Chang, C., Eom, S.H., Hwang, K .Y. & Cho, Y. , Yu, Y. G., Ryu, S.E., Kwon, S.T. & Suh, S.W. (2000) Crystallization and preliminary X-ray crystallographic analysis of NAD + -dependent DNA ligase ... Hakansson,K.,Doherty,A.J.,Shuman,S.&Wigley,D.B.(1997) X-ray crystallography reveals a large conformational change during guanyl transfer by mRNA capping enzymes. Cell 89,545– 553. 31....

Ngày tải lên: 21/02/2014, 01:21

... Lewy b ody (LB), LB variant of AD, m ultiple system atrophy and Hallervorden-Spatz disease (deposition of a-synuclein in form of LBs and Lewy neurites (LNs) [13± 17]). Finally, intrinsically unstructured ... other natively unfolded proteins may possess the same property. In fact, the analysis of hydrodynamic data s hows t hat two of the three consid ered proteins (a-synuclein and prothymosin...

Ngày tải lên: 08/03/2014, 16:20

... amino and carboxy termini, respectively. The identity of the peptide was verified by mass spectrometry (mass ¼ 2700.9). The wild-type HIV gp41 ectodomain was prepared as previously described [11]. ... hydrophobic interaction site on gp41 [10,18,29]. Consequently, the trifluoroethanol/aqueous mixture may very well mimic the hydrophobic environment of the gp120 C5 domain in vivo. Interestingly,...

Ngày tải lên: 08/03/2014, 16:20

... that are structurally related but highly polymorphic. These proteins were originally identified as colony-opacity-associated (Opa) proteins [1]. Opa proteins appear to play a critical role in ... membranes [21] (generously donated by M. Achtman, Max-Planck Institute, Berlin, Germany). This preparation was successfully used previously to detect CEACAM binding in a dot-blot assay [10]. The N-...

Ngày tải lên: 17/03/2014, 10:20

... ecdysteroids in a dose-dependent manner. This was shown in vivo by a yeast two-hybrid system and in vitro by a modified electromobility shift assay. Further- more, the EcR fragment expressed in yeast ... functional and bound radioactively labelled ecdysteroid specifically. Ligand binding was greatly enhanced by the presence of a USP ligand binding domain. Therefore, ecdysteroids are capable...

Ngày tải lên: 18/03/2014, 01:20

... ADP-ribosylated by diphtheria toxin [25]. ADP-ribosylation inhibits the activity of eEF2. Phosphorylation of eEF2 inhibits its activity, in translo- cation and in poly(U)-directed polyphenylalanine synthesis [26,27], ... in the accompany- ing review by Proud [1]. Insulin has subsequently been shown to decrease eEF2 phosphorylation in primary cell types such as adipocytes [50] and ventricular...

Ngày tải lên: 23/03/2014, 21:20

... terminal carboxylate oxygens in dark blue, adapted from Egea et al. [52]). (C) This shows methyl epoxyfarnesoic acid (yellow carbon backbone and blue terminal carboxylate oxygens) lain manually in the ... two other natural tryptophan residues (on a-helix 5) upon binding of methyl epoxyfarnesoate. Alternatively, if a-helix 12 does move in position upon binding of methyl epoxyfar- nesoate,...

Ngày tải lên: 23/03/2014, 21:20

... K562 lysis by freshly isolated NK cells or by a strongly cytolytic cd T cell line [35]. NK cell lysis in the presence of Va extract was Fig. 1. V. album extract (VaE) enhances cytolytic activity ... Kit (Miltenyi Biotec GmbH, Bergisch- Gladbach, Germany). The phenotype of isolated cells was analyzed by flow cytometry with CD16 mAb and CD56 mAb (clone 3G8 and N901-NKH1, respectively; Immuno- te...

Ngày tải lên: 31/03/2014, 15:20

... LAGYGYGLPLSRLYAR IK+SD GGG+ R+ L RIFTY+YSTA P +AGYGYGLPISRLYAR G1-box G2-box YFGGDLQIISMEGYGTDAYLHL-SRLGDSQEPLP YFGGDLQIISMEGYGTDAYLHL-SRLGDSEEPLP YFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHHYQTIQEAGDWCVPSTE ... IKVSDEGGGIARSGLPRIFTYLYSTARNPLEEDVDLGIADVPVTMAGYGYGLPISRLYAR IKISDEGGGIPRSGLSRIFTYLYSTAENPPD LDGHNEG-VTMAGYGYGIPISRLYAR IKMSDRGGGVPLRRIERLFSYMYSTAPTPQPGTGG TPLAGFGYGLPISRLYAK...

Ngày tải lên: 31/03/2014, 15:20