Báo cáo khoa học: "Generation of VP Ellipsis: A Corpus-Based Approach" ppt
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf
... Methyl a- d-glucopyranoside was used as a glucose analog that is not a substrate of hexokinase in a glucose assay system. The data were analyzed on thebasis of the Michaelis–Menten equation; the maximumactivity ... weights of activated carbon (Wako PureChemical, Osaka, Japan) and Celite (Wako Pure Chemical)(Fig. S4). The column was maintained at 15 °C, and wasthen washed with water until the glucose was completelyeluted. ... (pH 6.8) at 25 °C. A suit-able volume of mixture was sampled at various time points,and the reaction was stopped by addition of NaOH at a final concentration of 10 mm. After the samples had beenimmediately...
- 10
- 661
- 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt
... Pharmacology, University of Calgary, Alberta, Canada2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, AustraliaLong-range signalingBiological organs display coordinated ... membrane depolarization activating oradvancing the phase of other Ca2+stores. The electricaland chemical transduction pathways are as depicted inFig. 3. The key mechanisms are as follows: (a) ... impedance, and hence require a massive amount of current to cause pacemaker depo-larization. On the basis of experimental and theoreticalconsiderations, we now consider how Ca2+oscillationscan...
- 8
- 709
- 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx
... MINIREVIEWSynchronization of Ca2+oscillations: a capacitative (AC)electrical coupling model in neuroepitheliumMasayuki YamashitaDepartment of Physiology I, Nara Medical University, Kashihara, JapanStructural ... packed in the basallayer (Fig. 1C). The voltage fluctuations of the Ca2+store will induce ACs, which can pass the series capaci-tance of the ONM and the plasma membrane as capa-citative currents ... nucleoplasm.Capacitative electrical coupling of Ca2+release M. Yamashita294 FEBS Journal 277 (2010) 293–299 ª 2009 The Author Journal compilation ª 2009 FEBSCapacitative [alternating current (AC)]...
- 7
- 641
- 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc
... presence of ATP, with concomitant generation of ETA and ETA -A fragments. Incubation in theabsence of ATP revealed a small amount of degrada-tion for intact ETA, whereas no degradation wasobserved ... postinjection)ABFig. 1. Kinetics of appearance of ETA in hepatic plasma membranes and endosomes after toxin administration. Rat hepatic plasma mem-brane (A) and endosomal fractions (B) were isolated at ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig....
- 15
- 588
- 0
Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx
... polymerase a- primase complex during meiosisinCoprinus cinereusSatoshi Namekawa, Fumika Hamada, Tomoyuki Sawado†, Satomi Ishii, Takayuki Nara‡, Takashi Ishizaki,Takashi Ohuchi, Takao Arai and ... Hatanaka, M., Kimura, S., Oshige, M., Tsuya, Y.,Mizushina, Y., Sawado, T., Aoyagi, N., Matsumoto, T., Hashi-moto, J. & Sakaguchi, K. (1998) Purification and characterization of a 100 kDa ... chromosomepairing. Mol. General Genet. 262, 781–789.28. Hamada, F., Namekawa, S., Kasai, N., Nara, T., Kimura, S.,Sugawara, F. & Sakaguchi, K. (2002) Proliferating cell nuclearantigen from a basidiomycete,...
- 10
- 476
- 0
Báo cáo khoa học: ` Inhibition of human ether a go-go potassium channels by 2+ Ca ⁄calmodulin binding to the cytosolic N- and C-termini potx
... presented as an array of short peptides, attachedto a cellulose membrane. Detection of CaM bindingwas realized by BODIPY FL labeling of recombinantlyproduced MCGS-(H)6-hCaM. Analysis of this assayresulted ... voltage of half-maximal gate activation and kmthe corresponding slope factor. G is the maximal conduct-ance of all channels and Erevthe reversal potential.AcknowledgementsThis work was ... ‘–’ and ‘+’ indicate absence andapplication of about 1 lM CaM in 1 lM Ca2+solutions. (B) Similarexperiments as in (A) for a single patch with hEAG1 channelsbefore (–) and after (+) application...
- 13
- 500
- 0
Báo cáo khoa học: "Prediction of Learning Curves in Machine Translation" ppt
... LinguisticsPrediction of Learning Curves in Machine TranslationPrasanth Kolachina∗Nicola Cancedda†Marc Dymetman†Sriram Venkatapathy†∗ LTRC, IIIT-Hyderabad, Hyderabad, India† Xerox Research Centre ... Since ad-hoc manual translation canrepresent a significant investment in time andmoney, a prior assesment of the amount of training data required to achieve a satisfac-tory accuracy level can ... that a given amount of additionaltraining data is more advantageous when added to a small rather than to a big amount of initial data.The last condition is related to our use of BLEU —which...
- 9
- 374
- 0
Báo cáo khoa học: "Impact of computerized physician order entry on medication prescription errors in the intensive care unit: a controlled cross-sectional trial"
... KC wasresponsible for conceiving the study, data acquisition, analysis of the data, statistical analysis and drafting of the manuscript.BC was responsible for data acquisition, analysis of the ... fileand the laboratory data. Renal function was noted for everypatient and renal failure was defined as calculated creatinineclearance less than 50 ml/minute. The parameters needed tocalculate ... creatinine clearance were always available inboth the PB-U and the C-U. In addition to the pharmacists'own professional knowledge, clinical guidelines (Up to Date®,Waltham, MA, USA) and...
- 9
- 738
- 1
Báo cáo khoa học: " Effect of the medical emergency team on long-term mortality following major surgery"
... incomingpatients, including rapid stabilization of vital parameters, phys-ical and neurological examination, radiography and laboratoryanalysis. Patients on catecholamines upon arrival showed ... traumatic exposure to contaminated water[22,24] as well as pulmonary complications and septicemiafollowing near drowning [25-34]. Although atypical mycobac-teria and anaerobic bacteria may also ... counselling.ResultsWound managementPhysical examination upon arrival at the ER revealed a pattern of severe large-scale soft-tissue damage common to 16/17victims. Multiple large flap lacerations at various body...
- 9
- 761
- 0
Báo cáo khoa học: "Effect of intern’s consecutive work hours on safety, medical education and professionalism"
... not wane as workhours are curtailed and that a ‘shift-work’ mentality does notcompromise care.Competing interestsCAC was paid an honorarium to deliver a plenary address foran annual educational ... [3]. A systemic-level approach rather than a within-subjects analysis was used in comparing interns’serious medical error rates, making these analysescomparable with analyses of errors system wide ... hospital remains to be tested, and shouldbe a major focus of future work.Authors’ responseEric B Milbrandt, Babak Sarani and Louis H AlarconWe would like to thank Dr Landrigan, Dr Lockley, and...
- 3
- 514
- 0
Từ khóa: Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtBÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM