Báo cáo khoa học: Characterization of the bioactive conformation of the C-terminal tripeptide Gly-Leu-Met-NH2 of substance P using [3-prolinoleucine10]SP analogues pdf

... Ó FEBS 2003 Characterization of the bioactive conformation of the C-terminal tripeptide Gly-Leu-Met-NH 2 of substance P using [3-prolinoleucine10]SP analogues Jean Quancard, Philippe Karoyan, ... the NK-1 receptor. The structural implications of these results on the bioactive conformation of Leu10 and the C-terminal tripeptide of SP are an...

Ngày tải lên: 08/03/2014, 02:21

... Cg-Clp2 appears to be expressed in both epithelial and conjunctive cell types of the mantle edge, this protein could orchestrate the synthesis of extracellular components and ⁄ or the pro- liferation ... pro- liferation of mantle cells, as was proposed for Cg-Clp1 [5]. The postspawning gonad is characterized by the resorption of gonadic tubules and the rebuilding of stor...

Ngày tải lên: 19/02/2014, 00:20

... The 5¢-UTRs of the DNASE1 messages were separately amplified by RT-PCR of total QGP-1 RNA with a primer set of the common reverse primer DN+89 and either of the starting exon-specific forward primers ... 476-bp 5¢-RACE DNA product, of which the 3¢ 380 bp were identical to exons 1–3 from the 5¢-end of the reverse primer DN+231 to the 5¢-end of the region where th...

Ngày tải lên: 19/02/2014, 06:20

... of the first 88 amino acids of PPI1 may participate in the interaction with the H + -ATPase and makes PPI1 588 His 6 a suitable tool to study the mechanism of action of PPI1. The analysis of the ... func- tion of the concentration of His 6 PPI1 88 and PPI1 588 His 6 . PM treat- ment with the specified concentrations of His 6 PPI1 88 (closed triangles) or PPI1 588...

Ngày tải lên: 19/02/2014, 07:20

... stand for Sno 1p, Snz 1p and His-tag, respectively. Name of plasmid Primer VectorForward Backward pSNO1 P1 O P2 O pET21d pSNO1H P1 OH P2 OH pET24a pSNZ1 P1 Z P2 Z pET21d pSNZ1H P1 ZH P2 ZH pET24a 746 Y ... over the entire surface of synthetic medium plates supplemented with pyridoxine and the growth requirements, and the plates were incubated at 30 °C. The colonies that a...

Ngày tải lên: 19/02/2014, 12:20

... sense primer) vs. its complement generating pGL3b:Prm3 AP)1 *, pGL3e: Prm3 AP)1 *, pGL3b: Prm3a AP)1 *, pGL3e:Prm3a AP)1 *, pGL3b:Prm3ab AP)1 *, pGL3e: Prm3ab AP)1 *, pGL3b: Prm3aa AP)1 *, pGL3e:Prm3aa AP)1 *, ... protein coupled receptor (GPCR) superfamily, the TXA 2 receptor or TP is pri- marily coupled to Gq-dependent activation of phos- pholipase (PLC) Cb isoforms [1,3]. In humans, bu...

Ngày tải lên: 19/02/2014, 16:20

... (GalpA) 2 (Table 1). Subsite mapping On the basis of the assumptions of Hiromi [30] that the intrinsic rate of hydrolysis (k int ) in the productive complex is independent of the length of the substrate, K m and ... QAVIVTLSYADNNGTIDYTPAKVPARFYDFTVKNVTVQDSTGSNPAIEITGDSS : 482 RsolPehC : RGGYVRDFHVDNV TLPNG VSLTGAGYGSGLLAGSPINSSVPLGVGARTSANPSASQGGLITFDCDYQP-AK : 513 Ththe...

Ngày tải lên: 20/02/2014, 03:20

... (CD11b). The purities of ICAM-1Fc, ICAM-2Fc and ICAM-4Fc fusion proteins were checked by SDS/PAGE. The preparations contained the expected recombinant proteins and the purity of the proteins ... been mapped in detail but the epitope for activation dependent mAb 7E3 has been localized to the amino-terminal region of the CD11b I domain [42] overlapping partially with the...

Ngày tải lên: 20/02/2014, 11:20

... located within the 0.5 kb stretch of the sequence between the SalI and SacI sites upstream of exon 1, and that putative suppressor elements are present between the PstI(approxi- mately 2.5 kb upstream of the ... transcription start sites [33]. The cap site-labeled cDNA library derived from murine kidney was supplied by Nippon Gene Co., Ltd. (Toyama, Japan). The library was...

Ngày tải lên: 21/02/2014, 03:20

... max. plot of 350–550 nm. The values represent the proportion of each dialdehyde in the sum of the three peak areas. (B) Incubations with apo-10¢-lycopenal (C 27 ), 3-OH-c-car- otene and lycopene. ... of the products formed. In a first approach, we checked the site specificities using synthetic apocarote- nals packed in octyl-b-glucoside micelles. This enabled us to observe...

Ngày tải lên: 07/03/2014, 03:20