Báo cáo khoa học: " German Sentence Recognition" ppt

Báo cáo khoa học: " German Sentence Recognition" ppt

Báo cáo khoa học: " German Sentence Recognition" ppt

... assigns one or more distinct immediate constituent analyses to every German sentence, thus indicating which of all possible sentences any given sequence of words may represent, and revealing all ... Structures, 'S-Gravenhage, The Hague, 1957. German Sentence Recognition 115 mar which must have been applied in order to produce that particular sentence. The middle step, there...

Ngày tải lên: 07/03/2014, 18:20

7 377 0
Báo cáo khoa học: "Automatic Acronym Recognition" pptx

Báo cáo khoa học: "Automatic Acronym Recognition" pptx

... an- notated using XML tags. For the majority of the cases there exist one acronym-definition pair per sentence, but there are cases where two or more pairs can be found. 4.2 Experiment and Results The

Ngày tải lên: 17/03/2014, 22:20

4 251 0
Tài liệu Báo cáo khoa học: The RNA recognition motif, a plastic RNA-binding platform to regulate post-transcriptional gene expression ppt

Tài liệu Báo cáo khoa học: The RNA recognition motif, a plastic RNA-binding platform to regulate post-transcriptional gene expression ppt

... ILFVTGVHEEATEEDIH-DKFAE YGEIKNI HLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM GQPISVD 147 UPF3 (1UW4) 52 KVVIRRLPPTLTKEQLQEHLQPM PEHDYFE FFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPA 131 U2AF65 (1U2F) 150

Ngày tải lên: 19/02/2014, 17:20

14 428 0
Báo cáo khoa học: "Chinese sentence segmentation as comma classification" ppt

Báo cáo khoa học: "Chinese sentence segmentation as comma classification" ppt

... for detecting commas that signal sentence bound- aries. 1 Introduction Sentence segmentation, or the detection of sentence boundaries, is very much a solved problem for En- glish. Sentence boundaries can ... suggests is that we can get reasonable sentence segmentation accuracy without having to parse the sentence (or rather, the multi -sentence group) first. The sentence segment...

Ngày tải lên: 07/03/2014, 22:20

5 328 0
Báo cáo khoa học: "Incorporating speech recognition confidence into discriminative named entity recognition of speech data" ppt

Báo cáo khoa học: "Incorporating speech recognition confidence into discriminative named entity recognition of speech data" ppt

... (10,718 sentences) and 18,200 NEs in eight categories (artifact, or- ganization, location, person, date, time, money, and percent). The sentences were read by 106 speakers (about 100 sentences ... τ, t]|X) =  W ∈W [w;τ,t]  p(X|W ) (p(W )) β  α p(X) , (1) where W is a sentence hypothesis, W [w; τ, t] is the set of sentence hypotheses that include w in [τ, t], p(X|W ) is a acoustic model...

Ngày tải lên: 17/03/2014, 04:20

8 311 0
Báo cáo khoa học: " Named Entity Recognition using an HMM-based Chunk Tagger" pptx

Báo cáo khoa học: " Named Entity Recognition using an HMM-based Chunk Tagger" pptx

... whole could be considered as the "who", "where" and "how much" in a sentence. NER performs what is known as surface parsing, delimiting sequences of tokens that answer ... In this way, further processing could discover the "what" and "how" of a sentence or body of text. While NER is relatively simple and it is fairly easy to build a...

Ngày tải lên: 17/03/2014, 08:20

8 473 1
Báo cáo khoa học: Key substrate recognition residues in the active site of a plant cytochrome P450, CYP73A1 ppt

Báo cáo khoa học: Key substrate recognition residues in the active site of a plant cytochrome P450, CYP73A1 ppt

... (Stras- bourg, France). L (–)-Phenylalanine and naphthalene-1-acetic acid were from Merck (Schuchardt, Germany). 2-Amino- quinoline and 2-phenoxyacetamidine were from Maybridge (Tintagel, UK), 5-hydroxy-2-indolecarboxylic

Ngày tải lên: 17/03/2014, 10:20

12 380 0
Báo cáo khoa học: "Named Entity Recognition without Gazetteers" ppt

Báo cáo khoa học: "Named Entity Recognition without Gazetteers" ppt

... or two. In the sentence "Mason, Daily and Partners lost their court case" it is clear that "Mason, Daily and Partners" is the name of a company. In the sentence "Unfortunately, ... Similarly, the system postpones the markup of unknown organizations whose name starts with a sentence initial common word, as in "Suspended Ceiling Contractors Ltd denied...

Ngày tải lên: 24/03/2014, 03:20

8 283 0
Từ khóa:
w