Báo cáo khoa học: A novel prokaryotic L-arginine:glycine amidinotransferase is involved in cylindrospermopsin biosynthesis potx

... that differs from that of the eukaryotic l-arginine:glycine amidinotransferases. Abbreviations AGAT, human L-arginine:glycine amidinotransferase; AmtA, L-arginine:lysine amidinotransferase; ANS, ... performed using primers cyrA-F (5¢-CATATGCAAACAGAATTGTAAATAGCT- 3¢) and cyrA-R (5¢-CTCGAGAATAATGATGAAGCGA- GAAAC-3¢), which incorporated NdeI and XhoI restriction sites, respectively. The cy...

Ngày tải lên: 06/03/2014, 22:21

... A novel c- N -methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 Calin B. Chiribau 1 , Cristinel Sandu 1 , ... of natural and man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthro...

Ngày tải lên: 19/02/2014, 16:20

... subsequently, its binding to the calcineurin-dependent response element in a variety of promoters including that of ENA1.Asanalternative ,a ceramide-activated phosphatase rather than calcineurin may be considered ... Salt-stress-dependent induction of ENA1 involves the Ca 2+ /calmodulin-activated protein phospha- tase calcineurin [25], the TOR-GLN3 signalling pathway [27] and possibly al...

Ngày tải lên: 31/03/2014, 09:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... was calibrated using molecular mass standards and equilibrated with buffer A containing 150 mm KCl. Gel filtration was carried out with buffer A containing 150 mm KCl at a flow rat...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... Relative fluorescence intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean a...

Ngày tải lên: 18/02/2014, 18:20

... tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin receptor ... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isol...

Ngày tải lên: 19/02/2014, 00:20

... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... reaction mixture at 520 nm. The decrease in absorbance indicated an increase in mito- chondrial swelling and a decrease in mitochondria integrity. TBARS content in ferrous sulfate ⁄ as...

Ngày tải lên: 19/02/2014, 02:20

... Catania, Italy Pseudomonas stutzeri OXI is a Gram-negative microorgan- ism able to grow in media containing aromatic hydrocar- bons. A novel lipo-oligosaccharide from P. stutzeri OX1 was isolated ... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Esch...

Ngày tải lên: 19/02/2014, 13:20

... [6,8,27] or to any other sequences available in FASTA and BLAST database programs at the DNA Data Bank of Jap an. Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... 4-amino-3-hydroxybenzoic acid in strain 10d are revealed. Materials and methods Bacterial strain and growth conditions Bordetella sp. strain 10d was isolated previously [10]. S...

Ngày tải lên: 19/02/2014, 16:20

... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel...

Ngày tải lên: 20/02/2014, 09:20