Báo cáo khoa học: A novel ErbB2 epitope targeted by human antitumor immunoagents ppt

... extracellular domain of ErbB2 receptor; EDIA, Erbicin-derived immunoagent; ERB-hcAb, human compact antibody against ErbB2; ERB-hRNase, human anti -ErbB2 immunoRNase with Erbicin fused to human pancreatic ... FEBS ErbB2, termed Erbicin [7], with either a human RNase or the Fc region of a human IgG 1 , called Erb-hRNase and human compact antibody against ErbB2 (Erb- hcAb)...

Ngày tải lên: 06/03/2014, 00:21

... CumOOH, and NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing Chemical ... ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid reacts with malonal- dehyde and ⁄ or other carbonyl by- products of free-radi...

Ngày tải lên: 19/02/2014, 02:20

... a sample text each lexical chain is regarded as a concept that ex- presses the meaning of a document. Therefore, each concept was extracted by lexical chains. For example, Figure 1 shows a sample ... information ra- tio rather than information quantity as the semantic weight of indexes. This approach has an advantage in that we need not consider document length when indexing because...

Ngày tải lên: 23/03/2014, 19:20

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard deviation o...

Ngày tải lên: 18/02/2014, 18:20

... vulgaris). Biochem J 387, 85–91. 25 Kanda A, Takahashi T, Satake H & Minakata H (2006) Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus...

Ngày tải lên: 19/02/2014, 00:20

... carbohydrate backbone, was carried out by mild hydrazinolysis (de-O- acylation) followed by de-N-acylation using hot KOH. The lipo-oligosaccharide was also analyzed after acid treatment, attained by mild ... Gram-negative bacteria, and their adaptability to many different pollutants [1]. Pseudomonas stutzeri OX1 is a Gram-negative bacterium isolated from the activated sludge of a wa...

Ngày tải lên: 19/02/2014, 13:20

... (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and pentafluorophenylhydrazine was from Pfaltz & Bauer. (Waterbury, CT, USA). DE52 cellulose was from ... only as a carbon source, but also as a nitrogen source for g rowth of the assimilating bacteria. Deaminases, which catalyze the release of ammonia, are a key enzyme in the metabolic pat...

Ngày tải lên: 19/02/2014, 16:20

... man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatest detail is the pathway of nicotine degradation as it takes place in Arthrobacter nicotinovorans ... c-N-methylamino- butyrate oxidase; megaplasmid pAO1; nicotine degradation; sarcosine o xidase. The bacterial soil community plays a pivotal role in the biodegradation of a n a lmost unlimited...

Ngày tải lên: 19/02/2014, 16:20

... tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based clas...

Ngày tải lên: 20/02/2014, 09:20