Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot
Tài liệu Báo cáo khoa học: "A Mobile Touchable Application for Online Topic Graph Extraction and Exploration of Web Content" ppt
... that are generated from an online
Encyclopedia (in our case Wikipedia). The relevant
background relation graph is also represented as a
touchable graph in the same way as a topic graph.
The major ... touch on
a node to display the associated snippets and web pages.
Since a topic graph can be very large, not all nodes are
displayed. Nodes, which can be expanded are marked by
the numb...
Tài liệu Báo cáo Y học: A pool of Y2 neuropeptide Y receptors activated by modifiers of membrane sulfhydryl or cholesterol balance pot
... inhibitor
was less than 5% of control values.
Ó FEBS 2002 Masked Y2 NPY receptors (Eur. J. Biochem. 269) 2319
PRIORITY PAPER
A pool of Y2 neuropeptide Y receptors activated by modifiers
of membrane sulfhydryl ... temperature (Fig. 5A) . A similar
fast activation was observed for Y2 receptors of rat
forebrain cells (not shown). This was contrasted by a...
Tài liệu Báo cáo khóa học: A multi-protein complex containing cold shock domain (Y-box) and polypyrimidine tract binding proteins forms on the vascular endothelial growth factor mRNA Potential role in mRNA stabilization pptx
... Adelaide,
North Terrace, Adelaide, South Australia, Australia
Vascular endothelial growth factor (VEGF) is a key regu-
lator of angiogenesis and post-transcriptional regulation
plays a major role in VEGF ... and 46) were then imme-
diately added and RNase T1 digested complexes analyzed by gel shift
assay. Cytoplasmic complexes CC4 4a, CC44b and CC46 and unbound
RNA probe are indicated...
Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx
... information for the functional analysis of
plant DEVH box RNA helicases, and suggest that AtHELPS, as an impor-
tant negative regulator, plays a role in K
+
deprivation stress.
Abbreviations
ABA, ... HH, Tian X, Li YJ, Wu CA & Zheng CC (2008)
Microarray-based analysis of stress-regulated micro-
RNAs in Arabidopsis thaliana. RNA 14, 1–8.
58 Xue H, Yang YT, Wu CA, Yang GD, Zhang MM &a...
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt
... Hamaguchi T, Iizuka N, Tsunedomi R, Hamamoto Y,
Miyamoto T, Iida M, Tokuhisa Y, Sakamoto K, Taka-
shima M, Tamesa T et al. (2008) Glycolysis module
activated by hypoxia-inducible factor 1alpha ... Miyazaki A, Nabeta Y, Hiroh-
ashi Y, Kanaseki T, Yamaguchi A, Yamada N, Hiray-
ama K, Suzuki M et al. (2002) Natural antigenic
peptides from squamous cell carcinoma recognized by
autolo...
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc
... Experi-
mental procedures, the rate of assimilate export from
photosynthetically active source organs to consuming
sink organs or metabolic pathways other than carbo-
hydrate pathways was calculated as ... slightly lower mean rates of carbon uptake
before and during the first day of cold acclimation.
After 3 days of cold exposure, the mean rate of carbon
uptake was significantly low...
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt
... I, Akinaga A, Kitano H,
Yokoyama K, Satomura M, Kurosawa T, Watanabe
M, Kawabata T, Chang W et al. (2009) Automated
immunoassay system for AFP-L3% using on-chip
electrokinetic reaction and separation ... development of better tools for glycan
analysis by MS
n
techniques.
We are currently building a spectral library of gly-
can structures by measuring MS
n
spectra of a variety...
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc
... for the mRNA of b-catenin
were 5¢-AAAGCTGATATTGATGGACAG-3¢. The siRNA
against luciferase mRNA was used as a control siRNA.
The target sequence for luciferase mRNA was 5¢-AACG
TACGCGGAATACTTCGA-3¢. ... Dasgupta C, Sakurai R, Wang Y, Guo P, Ambalava-
nan N, Torday JS & Rehan VK (2009) Hyperoxia-
induced neonatal rat lung injury involves activation of
TGF-b and Wnt signaling, protecti...
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt
... ob
mice and genetically matched lean mice. Levels of miRNA expres-
sion were analyzed by TaqMan quantitative PCR. Data are mean
value ± standard errors of the mean from four individual mice of
each ... and was regulated by
hypoxia, an important extracellular stress associated with obesity. Our data
strongly suggest that miR-27 represents a new class of adipogenic inhibitors
and...
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335
E.
coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321
A.
pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (http://align.genome.jp/).
Acknowledgements
This study was partially supported by a Grant-in-Aid
for Exploratory Research from the Japan Society for
the Promotion of Science and a...