Tài liệu Báo cáo Y học: A novel, inducible, citral lyase purified from spores of Penicillium digitatum docx

... the actions of a hydratase and an aldolase are needed. Citral lyase of P. digitatum combines hydratase and aldolase activity in a single enzyme. No other enzyme has been reported to catalyse ... specificity Arangeofa,b-unsaturated aldehydes were tested as substrates for citral lyase (Table 2). As the total activity of the partially purified citral lyase is relatively l...

Ngày tải lên: 21/02/2014, 01:21

... those of extradiol dioxygenases available in the FASTA AND BLAST database programs at the DNA Data Bank of Japan. The gene encoding 4-amino-3-hydrox- ybenzoate 2,3-dioxygenase is currently being ... characterization Physiological and biochemical parameters, such as Gram reaction, flagella type, catalase activity, oxidase activity and OF test, were determined using classical methods [15]....

Ngày tải lên: 21/02/2014, 01:21

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS 163 E. coli 103 -EYTCDALIIATGASA RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT 157 A. pernix 115 LEVKARTVILAVGSRR RKLGVPGEAELAG...

Ngày tải lên: 18/02/2014, 08:20

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ (antisense). Caspase 3 activity Cells subjected ... intensity was determined using imagemaster 2d elite software 4.01 (Amersham Bioscience, Uppsala, Sweden). Statistical analysis Data in bar graphs are expressed as the mean and standard d...

Ngày tải lên: 18/02/2014, 18:20

... tachykinins: a review. Zool Sci 5, 533–549. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy- ama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... salivary vasodilator of the yel- low fever mosquito, Aedes aegypti. Insect Mol Biol 8, 459–467. 10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isol...

Ngày tải lên: 19/02/2014, 00:20

... ascorbate-treated mitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid reacts with malonal- dehyde and ⁄ or other carbonyl by-products of free-radical- mediated ... NADPH were also obtained from Sigma. Sephadex G-25 was pur- chased from Pharmacia (Uppsala, Sweden). All the other materials were of analytical grade and obtained from Beijing C...

Ngày tải lên: 19/02/2014, 02:20

... & Brade, H. (1994) Preparation and structural analysis of oligosaccharide monophosphates obtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Escherichia ... carbohydrate backbone, was carried out by mild hydrazinolysis (de-O- acylation) followed by de-N-acylation using hot KOH. The lipo-oligosaccharide was also analyzed after acid treatment, att...

Ngày tải lên: 19/02/2014, 13:20

... N,O-bis(trimethylsilyl)-tri- fluoroacetoamide, NADPH, and glutamate dehydrogenase were from Wako Pure Chemicals (Osaka, Japan); meat extract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo (Osaka, Japan); and ... enzyme and purified 4-amino- 3-hydroxybenzoate 2,3-dioxygenase in a coupled assay was identified as 2-hydroxymuconic 6-semialdehyde by GC-MS analysis. A mechanism for the fo...

Ngày tải lên: 19/02/2014, 16:20

... oxidase activity, may indicate an evolutionary relationship to sarcosine oxidases, enzymes largely distributed among soil bacteria. MABO may have evolved from a sarcosine oxidase by adjustment of ... noncovalently flavinylated Fig. 3. The ORF63 protein is a demethylating c-N-methylaminobuty- rate oxidase (MABO). (A) M ABO analysed b y PAGE on nondena- turing 10% (w/v) polyacrylamide...

Ngày tải lên: 19/02/2014, 16:20

... phrase chunking information and semi-automatically collected country name list and personal relative trigger word list. Jiang and Zhai (2007) then systematically explored a large space of ... study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification is based on the following four t...

Ngày tải lên: 20/02/2014, 09:20