Tài liệu Báo cáo Y học: Inhibition of the MEK/ERK signaling pathway by the novel antimetastatic agent NAMI-A down regulates c-myc gene expression and endothelial cell proliferation ppt
Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx
... the production of methionine and S-AdoMet [6,7]. Furthermore, MetS is the only human enzyme that metabolizes methyltetra-hydrofolate to tetrahydrofolate, thereby facilitating the recycling of ... a cofactor [1]. MetS catalyses the transfer of the methyl group from 5-methyltetrahydrofolate tohomocysteine via the CH3-Cbl cofactor, with cycling of cobalamin between the +1 [Cbl(I)] and ... FEBS 287pathways. These include the reactions of trans-sulfura-tion through the production of homocysteine, biologi-cal methylations of DNA, lipids and proteins, and polyamine biosynthesis through...
- 13
- 424
- 0
Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx
... in the separ-ation of the daughter cells at the end of cell division and in cellular autolysis [9], where it mediates the release of toxins that damage the host tissues and allows the entry of ... the structures of both the ligated and unligated forms of C-LytA, due to the insolubility of the protein at the required concentra-tions. The recently solved structures of the phage Cpl-1lysozyme ... both cell viability and liberation of viru-lence factors. Inhibition of autolysis by excess cho-line might, in the first instance, seem to be of therapeutic interest. However, the amount of ligandneeded,...
- 13
- 465
- 0
Tài liệu Báo cáo khoa học: Inhibition of pea ferredoxin–NADP(H) reductase by Zn-ferrocyanide docx
... [51,52]. The O of Ser90 and the S of Cys266 of pea FNR are closeto N5 and O4 of the isoalloxazine, which are involved inhydride transfer. The hydroxy group of Ser90 could accept ahydrogen bond and ... presence of the inhibitor, and disrupting the electrontransfer between the flavin and the second substrate mainlycauses enzyme inhibition by Zn-ferrocyanide.Effect of Fld on the inhibition of FNR ... between the N5 and O4 of the flavin, O of Ser90, S of Cys266, O of Glu306 and O of Tyr308 indicate that almost all of them areat bond distances between each other and nearly o rientedcorrectly to...
- 12
- 585
- 0
Tài liệu Báo cáo khoa học: Modulation of F0F1-ATP synthase activity by cyclophilin D regulates matrix adenine nucleotide levels pptx
... of CYPDor its inhibition by cyclosporin A significantlyenhanced the rate of F0F1-ATP synthase-mediatedregeneration of ATP consumed by arsenolysis in the matrix and decreased the extent of ... ablation of the ppif gene or inhibi-tion of CYPD binding on F0F1-ATP synthase by cyclosporin A led to a disinhibition of the ATPase,resulting in accelerated ATP synthesis and hydrolysisrates.However, ... of CYPD by cyclosporin A or genetic ablation of the ppif gene [4–7] negatively affect the PTP openingprobability. CYPD inhibition or its genetic ablationexhibit an unquestionable inhibitory...
- 14
- 627
- 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc
... DFQPP-YFPPPY QPLPYHQSQDP YSHVN-DPYS LNPLHQ-PQ Q Gamma GVA EYQPPPYFPPPY QQLAYSQSADP YSHLG-EAYAAAINPLHQPAPTGSQ Epsilon PAATAAAEFQPP-YFPPPYPQPPLPYGQAPDAAAAFPHLAGDPYGG-LAPLAQPQPP Delta TTG TEFASP-YFSTNHQYTPL-HHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQ ... of the AP-2 structure. Expression patterns of AP-2 molecules and functional implications The expression and function of AP-2 isoforms havebeen systematically analyzed during murine embryo-genesis ... functions of AP-2s in physiologicalprocesses, they have also crucial roles in pathologicalprocesses such as tumorigenesis and genetic diseases[47].Most analyses of the regulation of AP-2 and the interactions...
- 9
- 642
- 0
Tài liệu Báo cáo khoa học: ¨ Induction of Kruppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I pptx
... THP-1 cells, and the subsequentexpressions of SR-BI were analysed by real-time PCR and western blot. The binding and transcriptional activities of KLF4 to the SR-BI promoterwere detected by electrophoretic ... tosynthesize the complimentary cDNA using the First StrandSynthesis Kit (Invitrogen). The cDNA from this synthesiswas then used in quantitative real-time PCR analysis with the TaqMan system ... mononuclear cells (PBMCs) and human THP-1monocytes. In addition, the effects of KLF4 on the expression of SR-BI and the primary mechanism werealso investigated.ResultsHDL induces the expression of...
- 9
- 516
- 0
Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx
... methylglyoxal and 3-deoxygluco-sone in the glycation of proteins by glucose. Biochem J344, 109–116.23 Atkins TW & Thornalley PJ (1989) Erythrocyte gly-oxalase activity in genetically obese ... Group, The Heart Research Institute, Camperdown, Sydney, NSW, Australia2 Department of Health Sciences, University of Technology Sydney, NSW, Australia3 Faculty of Medicine, University of Sydney, ... [36]), consistent with poorcellular handling of the glycated apoB protein. Thismay be partly explained by the resistance of the modi-fied apoB to degradation by lysosomal cathepsins [40].In addition...
- 12
- 604
- 0
Tài liệu Báo cáo khoa học: Delineation of exoenzyme S residues that mediate the interaction with 14-3-3 and its biological activity ppt
... ADP-ribosylation of Rasrequires the Leu-428 residueRas is modified by the ADP-ribosylating activity of ExoS expressed and delivered into the eukaryotic cells by genetically modified Y. pseudotuberculosis ... fact that before the ADP-ribosylation activity of translocated ExoS causes cell death, the infected cells undergo a morphologychange whereby they round up due to disruption of actin microfilaments ... thatsubstitution of this leucine significantly weakens the ability of ExoS tomediate cell death. Leucine-428 is also required for the ability of ExoS tomodify the eukaryotic endogenous target Ras. Finally,...
- 9
- 525
- 0
Tài liệu Báo cáo khóa học: Inactivation of copper-containing amine oxidases by turnover products doc
... from the 350 nm band formed by Co- and Ni-AGAO, the LCAO band was not affected by the admission of oxygen in solution. Thus, the inactivatedprotein was unable to hydrolyze the aldehyde and to ... inactivated,slowly formed a band at 420 nm, typical of the 2-hydraz-inopyridine adduct of TPQ. The final band intensitymatched the residual activity of the solution. The reactionwas slow, implying previous ... amounts of H2O2, by the initialintensity of the radical spectrum and by the bleached500 nm band. Which of the two equilibrium species, the radical or the Cu2+-quinolamine, participated in the reaction...
- 7
- 434
- 0
Tài liệu Báo cáo khoa học: Binding of ligands originates small perturbations on the microscopic thermodynamic properties of a multicentre redox protein pptx
... essentially unaffected. Although neither of the lig-ands tested is a physiological partner of cytochrome c3, the small changesobserved for the thermodynamic properties of cytochrome c3bound tothese ... essentiallyundisturbed by the replacement of Fe by Zn in the rubredoxin given the identical structures of the twoprotein forms [38,39]. Therefore, at the concentrationsused in the NMR experiments over 90% of the cytochrome ... ener-gies of the four haems and the energies for deprotonating the acid–base centre for the fully reduced and protonated state of the protein and have standard errors < 5 meV. The off-diagonal...
- 10
- 640
- 0
Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctai lieu bao cao thuc tap y si da khoatai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhnghiên cứu các tài liệu báo cáo của các nhà nghiên cứu đi trước về các lập luận khoa học về trồng và phòng bệnh dịch cho hoa hồng cách quản lý sử dụng phân bón đúng cách vvbáo cáo y họctài liệu báo cáotài liệu báo cáo môn triếttài liệu báo cáo tài chínhtài liệu di truyền y họctài liệu báo cáo mônbáo cáo y họctài liệu báo cáo tài chính vốn bằng tiền tai doanh nghiệptài liệu vi sinh y họctài liệu báo cáo môn triếtquan hệ sản xuấtNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ