Tài liệu Báo cáo Y học: Inhibition of the MEK/ERK signaling pathway by the novel antimetastatic agent NAMI-A down regulates c-myc gene expression and endothelial cell proliferation ppt

Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx

Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx

... the production of methionine and S-AdoMet [6,7]. Furthermore, MetS is the only human enzyme that metabolizes methyltetra- hydrofolate to tetrahydrofolate, thereby facilitating the recycling of ... a cofactor [1]. MetS catalyses the transfer of the methyl group from 5-methyltetrahydrofolate to homocysteine via the CH 3 -Cbl cofactor, with cycling of cobalamin between the...

Ngày tải lên: 19/02/2014, 05:20

13 424 0
Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx

Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx

... in the separ- ation of the daughter cells at the end of cell division and in cellular autolysis [9], where it mediates the release of toxins that damage the host tissues and allows the entry of ... the structures of both the ligated and unligated forms of C-LytA, due to the insolubility of the protein at the required concentra- tions. The recently...

Ngày tải lên: 19/02/2014, 05:20

13 465 0
Tài liệu Báo cáo khoa học: Inhibition of pea ferredoxin–NADP(H) reductase by Zn-ferrocyanide docx

Tài liệu Báo cáo khoa học: Inhibition of pea ferredoxin–NADP(H) reductase by Zn-ferrocyanide docx

... [51,52]. The O of Ser90 and the S of Cys266 of pea FNR are close to N5 and O4 of the isoalloxazine, which are involved in hydride transfer. The hydroxy group of Ser90 could accept a hydrogen bond and ... presence of the inhibitor, and disrupting the electron transfer between the flavin and the second substrate mainly causes enzyme inhibition by Zn-ferr...

Ngày tải lên: 19/02/2014, 16:20

12 585 0
Tài liệu Báo cáo khoa học: Modulation of F0F1-ATP synthase activity by cyclophilin D regulates matrix adenine nucleotide levels pptx

Tài liệu Báo cáo khoa học: Modulation of F0F1-ATP synthase activity by cyclophilin D regulates matrix adenine nucleotide levels pptx

... of CYPD or its inhibition by cyclosporin A significantly enhanced the rate of F 0 F 1 -ATP synthase-mediated regeneration of ATP consumed by arsenolysis in the matrix and decreased the extent of ... ablation of the ppif gene or inhibi- tion of CYPD binding on F 0 F 1 -ATP synthase by cyclosporin A led to a disinhibition of the ATPase, resulting in accelerate...

Ngày tải lên: 14/02/2014, 19:20

14 628 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... DFQPP-YFPPPY QPLPYHQSQDP YSHVN-DPYS LNPLHQ-PQ Q Gamma GVA EYQPPPYFPPPY QQLAYSQSADP YSHLG-EAYAAAINPLHQPAPTGSQ Epsilon PAATAAAEFQPP-YFPPPYPQPPLPYGQAPDAAAAFPHLAGDPYGG-LAPLAQPQPP Delta TTG TEFASP-YFSTNHQYTPL-HHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQ ... of the AP-2 structure. Expression patterns of AP-2 molecules and functional implications The expression and function of AP-2 isofo...

Ngày tải lên: 16/02/2014, 09:20

9 642 0
Tài liệu Báo cáo khoa học: ¨ Induction of Kruppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I pptx

Tài liệu Báo cáo khoa học: ¨ Induction of Kruppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I pptx

... THP-1 cells, and the subsequent expressions of SR-BI were analysed by real-time PCR and western blot. The binding and transcriptional activities of KLF4 to the SR-BI promoter were detected by electrophoretic ... to synthesize the complimentary cDNA using the First Strand Synthesis Kit (Invitrogen). The cDNA from this synthesis was then used in quantitative real-time...

Ngày tải lên: 18/02/2014, 04:20

9 516 0
Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx

... methylglyoxal and 3-deoxygluco- sone in the glycation of proteins by glucose. Biochem J 344, 109–116. 23 Atkins TW & Thornalley PJ (1989) Erythrocyte gly- oxalase activity in genetically obese ... Group, The Heart Research Institute, Camperdown, Sydney, NSW, Australia 2 Department of Health Sciences, University of Technology Sydney, NSW, Australia 3 Faculty of Medicine, Un...

Ngày tải lên: 19/02/2014, 02:20

12 604 0
Tài liệu Báo cáo khoa học: Delineation of exoenzyme S residues that mediate the interaction with 14-3-3 and its biological activity ppt

Tài liệu Báo cáo khoa học: Delineation of exoenzyme S residues that mediate the interaction with 14-3-3 and its biological activity ppt

... ADP-ribosylation of Ras requires the Leu-428 residue Ras is modified by the ADP-ribosylating activity of ExoS expressed and delivered into the eukaryotic cells by genetically modified Y. pseudotuberculosis ... fact that before the ADP-ribosylation activity of translocated ExoS causes cell death, the infected cells undergo a morphology change whereby they round up due to...

Ngày tải lên: 19/02/2014, 08:20

9 525 0
Tài liệu Báo cáo khóa học: Inactivation of copper-containing amine oxidases by turnover products doc

Tài liệu Báo cáo khóa học: Inactivation of copper-containing amine oxidases by turnover products doc

... from the 350 nm band formed by Co- and Ni-AGAO, the LCAO band was not affected by the admission of oxygen in solution. Thus, the inactivated protein was unable to hydrolyze the aldehyde and to ... inactivated, slowly formed a band at 420 nm, typical of the 2-hydraz- inopyridine adduct of TPQ. The final band intensity matched the residual activity of the soluti...

Ngày tải lên: 19/02/2014, 12:20

7 434 0
Tài liệu Báo cáo khoa học: Binding of ligands originates small perturbations on the microscopic thermodynamic properties of a multicentre redox protein pptx

Tài liệu Báo cáo khoa học: Binding of ligands originates small perturbations on the microscopic thermodynamic properties of a multicentre redox protein pptx

... essentially unaffected. Although neither of the lig- ands tested is a physiological partner of cytochrome c 3 , the small changes observed for the thermodynamic properties of cytochrome c 3 bound to these ... essentially undisturbed by the replacement of Fe by Zn in the rubredoxin given the identical structures of the two protein forms [38,39]. Therefore, at the...

Ngày tải lên: 19/02/2014, 17:20

10 640 0
w