Tài liệu THE A P STATE CO OPERATIVE BANK LTD TROOP BAZAR: HYDERABAD docx

Tài liệu THE A.P. STATE CO.OPERATIVE BANK LTD TROOP BAZAR: HYDERABAD docx

Tài liệu THE A.P. STATE CO.OPERATIVE BANK LTD TROOP BAZAR: HYDERABAD docx

... the Andhra Pradesh State Co- operative Bank (APCOB). The operations of the Bank are fully computerized under a Core Banking System (CBS). As such, this Manual does not attempt to detail the ... obtained and affixed at the appropriate places in the account opening forms, specimen card and pass book. ii. In respect of Current and Savings Bank Accounts, one copy...
Ngày tải lên : 16/02/2014, 06:20
  • 162
  • 342
  • 0
Tài liệu Báo cáo khoa học: Co-operative effect of the isoforms of type III antifreeze protein expressed in Notched-fin eelpout, Zoarces elongatus Kner ppt

Tài liệu Báo cáo khoa học: Co-operative effect of the isoforms of type III antifreeze protein expressed in Notched-fin eelpout, Zoarces elongatus Kner ppt

... five recombinant isoforms, nfeAFP2 and nfeAFP6 (SP group), nfeAFP8 (QAE1 group), nfeAFP11 and nfeAFP13 (QAE2 group) so as to compare the TH activity between the groups. TH activity was also measured ... GESVVATQLIPINTALTPAMMEGKVTNPSGIPFAxMSQIVGKQVNTPxAKGQTLMP N1 GESVVATQLIPIN N2 TALTPAMMEGKVTNPSGIPFAxMSQIVGxQVN N3 TALTPAMMEGKVTN N4 PSGIPFAEMSQIVGxQVNTPVAxGQTL N5 MVKTYVPA T1 GESVVATQLIP...
Ngày tải lên : 19/02/2014, 16:20
  • 11
  • 696
  • 0
Tài liệu hóa 8 3 cột cả năm

Tài liệu hóa 8 3 cột cả năm

... nớc. C.Ph ơng ph p. -Phơng ph p trực quan.Vấn đ p. -Phơng ph p hoạt động nhóm. D.Hoạt động dạy học. 1ổn định l p: 1 / 2.Kiểm tra bài cũ. *Hs nhắc lại định ngh a phân tử. *Gv kiểm tra sự chuẩn ... cùng số proton trong hạt nhân. *Hs3:Ch a bài t p 5(SGKT16). -Neon: 2p, 2e,1 l p, 2e l p ngoài cùng. -Cacbon: 6p , 6e,2 l p, 4e l p ngoài cùng. -Nhôm: 1 3p, 13e,3 l p, 3e l p ngoài cùn...
Ngày tải lên : 02/12/2013, 23:11
  • 185
  • 374
  • 0
Tài liệu THE RED SHOES - truyện cổ Andersen doc

Tài liệu THE RED SHOES - truyện cổ Andersen doc

... looked at the red ones—looked at them again, and put on the red shoes. The sun shone gloriously; Karen and the old lady walked along the path through the corn; it was rather dusty there. At the ... with Karen. And all the people in the church looked at Karen’s red shoes, and all the pictures, and as Karen knelt before the altar, and raised the cup to her lips, s...
Ngày tải lên : 14/12/2013, 09:15
  • 7
  • 738
  • 3
Tài liệu The Art and Science of Operative Dentistry presents FOURTH EDITION ppt

Tài liệu The Art and Science of Operative Dentistry presents FOURTH EDITION ppt

... Louis  London  Philadelphia  Sydney  Toronto Preface cavity preparation has been replaced by tooth preparation for the reasons stated previously. Tooth preparation is still presented as a two-stage (initial and ... Terminology, 279 Classification of Tooth Preparations, 281 I NITIAL AND FINAL STAGES OF PREPARATION, 283 I nitial Tooth Preparation Stage, 285 Final Tooth Preparation Stage...
Ngày tải lên : 16/02/2014, 15:20
  • 963
  • 935
  • 1
Tài liệu Helping a Palestinian State Succeed docx

Tài liệu Helping a Palestinian State Succeed docx

... The state must establish and maintain effective gover- nance, rather than the corrupt and authoritarian rule that has prevailed since 1994. The state will have a large and rapidly growing population, ... for a Palestinian State, Santa Monica, Calif.: RAND Corporation, MG-327-GG, 2005. vi Helping a Palestinian State Succeed: Key Findings CHAPTER THREE The Arc: A Formal S...
Tài liệu Giá tham chiếu của cổ phiếu trong những ngày đặc biệt docx

Tài liệu Giá tham chiếu của cổ phiếu trong những ngày đặc biệt docx

... Giá tham chiếu c a cổ phiếu trong ngày giao dịch không hưởng phần chia lãi và đồng thời chia cổ tức bằng cổ phiếu Ví dụ : Công ty Haphaco đã được ph p c a UBCKNN chia cổ tức đợt hai bằng cổ phiếu ... tư phát triển sản xuất là mục đích quan trọng nhất c a TTCK và các doanh nghi p sẽ tranh thủ tối a nguồn vốn huy động bằng phương ph p này. 4) Giá tham chiếu c a cổ phiếu trong ngày gia...
Ngày tải lên : 09/12/2013, 19:15
  • 6
  • 1.2K
  • 3
Tài liệu Designing a Microsoft Windows Server 2003 Active Directory and Network Infrastructure docx

Tài liệu Designing a Microsoft Windows Server 2003 Active Directory and Network Infrastructure docx

... technicians. All users within the company have access to App1. App1 logs on to the App1 database by using a shared user account. The App1 database handles security within the database. Directory ... data that is transmitted over the network for App1. D. Install SNMP on all computers that are connected to App1 to obtain information about App1. E. Built a test environment f...
Ngày tải lên : 11/12/2013, 14:15
  • 52
  • 563
  • 1
Tài liệu The Insider’s Guide to PR: Chapter 3 PUBLIC RELATIONS DEFINED docx

Tài liệu The Insider’s Guide to PR: Chapter 3 PUBLIC RELATIONS DEFINED docx

... Financial PR team. Also, the team communicates primarily with certain groups of people, namely shareholders, investors and analysts, who need to receive company information in specific ways. A: ... like annual reports and quarterly results would be the kind of material the team communicates I suppose. I’m very impressed by what you offer here. I: There is more to come. We have a He...
Ngày tải lên : 13/12/2013, 04:15
  • 2
  • 655
  • 1
Tài liệu Tích tụ cholesterol - Nguy cơ tiềm ẩn gây đột quỵ não docx

Tài liệu Tích tụ cholesterol - Nguy cơ tiềm ẩn gây đột quỵ não docx

... tăng lipid trong máu là bệnh tăng lipid máu nguyên phát và tăng cholesterol gia đình. Tăng lipid máu nguyên phát có thể do môi trường ô nhiễm, nhiễm chất độc h a học, phóng xạ phối h p gây rối ... thế giới về dự phòng đột quỵ nhồi máu não bằng các thuốc “chống kết tiểu cầu” như aspirin, dipyridamol, clopidogreb, với phác đồ đơn lẻ, hoặc phối h p, liều lượng tối ưu thích h p nhất. Bằng...
Ngày tải lên : 14/12/2013, 20:15
  • 5
  • 365
  • 1