Tài liệu Báo cáo " The total specialization of modules over a local ring" ppt

Tài liệu Báo cáo " The total specialization of modules over a local ring" ppt

Tài liệu Báo cáo " The total specialization of modules over a local ring" ppt

... Journal of Science, Mathematics - Physics 25 (2009) 39-45 The total specialization of modules over a local ring Dao Ngoc Minh ∗ , Dam Van Nhi Department of Mathematics, Hanoi National University of ... about the total specializations of modules. We showed that the Cohen-Macaulayness, the Gorensteiness and Buchsbaumness of a module are preserved by the t...

Ngày tải lên: 13/02/2014, 03:20

7 503 1
Tài liệu Báo cáo " The extreme value of local dimension of convolution of the cantor measure" docx

Tài liệu Báo cáo " The extreme value of local dimension of convolution of the cantor measure" docx

... measure, Adv. in Applied Math., (to appear). [5] P. Shmerkin, ” A modified multifractal formalism for a class of self - similar measures with overlap”, Asian. J. Math., 9 (2005) 323. VNU Journal of ... Mathematics, Vinh University 2 Department of Fundamental Science, Vietnam academy of Traditional medicine Received 5 March 2009 Abstract. Let µ be the m−fold convolution of the...

Ngày tải lên: 13/02/2014, 03:20

12 428 0
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

... a glucose analog that is not a substrate of hexokinase in a glucose assay system. The data were analyzed on the basis of the Michaelis–Menten equation; the maximum activity (k cat ) and Michaelis ... results from the enzymatic activity of the acceptor reaction for the nigerooligo- saccharide with a degree of polymerization of 2–6 and methyl a- D-gluco- pyrano...

Ngày tải lên: 14/02/2014, 22:20

10 676 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

... Pharmacology, University of Calgary, Alberta, Canada 2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, Australia Long-range signaling Biological organs display coordinated ... coordinated activities that can extend over large distances. The spatial extent of signaling required for such long-distance coordination is many orders of magnitude greater than t...

Ngày tải lên: 16/02/2014, 09:20

8 710 0
Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

... space, because I C can pass the plasma membrane capacita- tively. Thus, the current loop can be closed via the extracellular space and the plasma membrane. This may allow capacitative electrical ... plasma membrane, and the cells are tightly packed in the basal layer (Fig. 1C). The voltage fluctuations of the Ca 2+ store will induce ACs, which can pass the series capaci- ta...

Ngày tải lên: 16/02/2014, 09:20

7 641 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... ETA -A in the presence of ATP, with concomitant generation of ETA and ETA -A fragments. Incubation in the absence of ATP revealed a small amount of degrada- tion for intact ETA, whereas no degradation ... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAIS...

Ngày tải lên: 18/02/2014, 04:20

15 588 0
Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx

Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx

... polymerase a- primase complex during meiosis in Coprinus cinereus Satoshi Namekawa, Fumika Hamada, Tomoyuki Sawado†, Satomi Ishii, Takayuki Nara‡, Takashi Ishizaki, Takashi Ohuchi, Takao Arai and ... P-40, and 20% sucrose. DNA primase assay TheDNAprimaseassayusingaDE81filterwasthesameas the DNA polymerase assay except that the RNA priming activity was monitored by Klenow enzyme (Fig. 5)....

Ngày tải lên: 20/02/2014, 11:20

10 476 0
Tài liệu Báo cáo " The meaning and structure of a science fiction story: a sysyemic functional analysis " doc

Tài liệu Báo cáo " The meaning and structure of a science fiction story: a sysyemic functional analysis " doc

... declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative declarative ... 18. astronauts 20. astronauts 21. they 13. man 23. the man 26. the man 26. the man anaphoric exophoric cataphoric anaphoric anaphoric anaphoric cataphoric anaphoric anaph...

Ngày tải lên: 12/02/2014, 20:20

18 714 4
Tài liệu Báo cáo " The effect of cobalt substitution on structure and magnetic properties of nickel ferrite " pptx

Tài liệu Báo cáo " The effect of cobalt substitution on structure and magnetic properties of nickel ferrite " pptx

... for a ion Ni 2+ and 5 μB for Fe 3+ . When x increased this leads to the compensation of ion Fe 3+ in the tetrahedral and octahedral location. That led to increasing of total magnetization of ... investigate structure and composition variations of the samples. All samples were found to have a cubic spinel structure. TEM was used to study morphological variations. The...

Ngày tải lên: 13/02/2014, 04:20

7 729 0
Tài liệu Báo cáo " The establishment of the Vietnam atomic time scale " docx

Tài liệu Báo cáo " The establishment of the Vietnam atomic time scale " docx

... maintaining the national time scale is one of the task which are belong to the national metrology institutes. In order to creating and maintaining a national time scale the time and frequency laboratory ... TA of another station can define local TA using their time difference. 3. Controlling the atomic clock performance As with the national time scales the Vietnam ti...

Ngày tải lên: 13/02/2014, 04:20

10 525 0
w