... Baseline 12 months 24 months 4 12 12 10 16 16 29 30 30 9 50 44 44 60 60 60 Group II (local anesthetic with steroids) (N = 60) Baseline 12 months 24 months 13 20 22 17 22 22 3 25 24 25 9 8* 43 ... effect of any solution injected into a closed space such as an intraarticular space or epidural space or over a nerve has not been appropriately evaluated Carette et al24 showed that patients responded ... 0.16 0. 32 ± 0.153 0 .22 0.45 ± 0. 125 0 .29 8 .22 ± 0.78 3.83 ± 3* 1 .29 3.48 ± 8* 1.36 7.93 ± 0.99 3. 52* ± 1.11 3 .28 * ± 0.83 0 .2 ± 0.085 28 0.1 16 0.3 ± 0.153 32 0 .2 22 0 .2 ± 0.3 32 20 0 .2 21 12 months...
Ngày tải lên: 26/10/2012, 09:07
... JavaScript Performance Reducing the Web Service Call Payload Loading the UI on Demand Using Read-Ahead Caching for Ajax Calls Hiding HTML Inside Summary 22 4 23 4 23 8 24 6 24 7 25 0 25 0 25 3 10 Solving ... Data access layer Encapsulates database access and provides an interface that is database and data source independent It also provides object factories that create Entity classes out of database ... with the database DatabaseHelper is a class used for performing common database operations DashboardDataContext is generated by LINQ to SQL and maps entities to database tables Data Model To...
Ngày tải lên: 15/11/2012, 14:24
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx
... 4b 100 2b 1b 1c 3d 3c 50 9a 9b 13 14 11 10 9c 28 14 20 29 5a 20 13 5c 5b 2a 32 28 27 a 27 b 26 3 1a 31b 31c 33 24 23 b 25 26 30 21 22 23 a 25 16 19 2b 15 13 17 18 23 b 25 29 11 17d 24 22 18 23 a 17c ... O75874 P11310 20 21 22 23 a 23 b 24 25 26 27 a 27 b P5 021 3 Q15084 P31937 P09 525 P09 525 P30101 P07339 P49411 P13804 P13804 28 P04406 29 P07355 30 P247 52 3 1a P 226 26 31b P 226 26 31c P 226 26 32 P21796 33 P45880 ... Distribution of glutaminase and glutamine synthetase FEBS Journal 27 2 (20 05) 3350–3364 ª 20 05 FEBS K Lenaerts et al 17 18 19 20 21 22 23 24 25 26 27 28 29 activities in the human gastrointestinal...
Ngày tải lên: 20/02/2014, 01:20
Art and design courses 2013 with a deadline of 24 March pot
... Duration: 2FT Fdg St Margarets Campus Campus code: WJ24 FdA Fashion and Costume Duration: 2FT Fdg W640 FdA Photography (with Video) Duration: 2FT Fdg WP15 BA 3D Animation and Games Duration: 3FT ... BA Animation Duration: 3FT Hon W2 32 BA Fashion Textiles Duration: 3FT Hon Art and design courses 20 13 (deadline 24 March) W101 BA Fine Art Duration: 3FT Hon R 52 - Rotherham College of Arts and ... WW26 BA Computer Animation Duration: 3FT Hon W230 BA Fashion Design Duration: 3FT Hon WN25 BA Fashion Promotion Duration: 3FT Hon W281 BA Game Art Duration: 3FT Hon W2 12 BA Graphic Communication...
Ngày tải lên: 31/03/2014, 15:20
Báo cáo hóa học: " Vaccination with a plasmid DNA encoding HER-2/ neu together with low doses of GM-CSF and IL-2 in patients with metastatic breast carcinoma: a pilot clinical trial" pptx
... AE, et al: Development of a xenogeneic DNA vaccine program for canine malignant melanoma at the Animal Medical Center Vaccine 20 06, 24 :45 82- 4585 Kutzler MA, Weiner DB: DNA vaccines: ready for prime ... immunotherapy, such as plasmid DNA (pDNA) vaccination, is an alternative approach to antibody therapy and several properties make Her2 a promising tumor vaccine candidate [10,11] While trastuzumab seems ... by a relative A4 50 index of >2 or a titer
Ngày tải lên: 18/06/2014, 16:20
Báo cáo sinh học: " Neopterin production and tryptophan degradation during 24-months therapy with interferon beta-1a in multiple sclerosis patients" docx
... http://www.translational-medicine.com/content/9/1/ 42 Statistical analysis Data were expressed as means, except for gender that was expressed as percentage (%) and EDSS for which median and standard error (SE) were used An Analysis of Variance ... titer in 20 μl of a pool of 20 sera before and after adding anti human IFN-beta antibody reference (G038501-5 72, National Institute of Health, Bethesda, USA) at high and low concentrations The ... IFN-beta mediated suppression of MMPs Brain 20 04, 127 :25 9 -26 8 Gilli F, Marnetto F, Caldano M, Sala A, Malucchi S, Capobianco M, Bertolotto A: Biological markers of interferon-beta therapy: comparison...
Ngày tải lên: 18/06/2014, 19:20
báo cáo hóa học:" Percutaneous endoscopic lumbar discectomy: clinical and quality of life outcomes with a minimum 2 year follow-up" doc
... Transforaminal percutaneous endoscopic discectomy in the treatment of far-lateral and foraminal lumbar disc herniations J Neurosurg 20 01, 94 (2 Suppl) :21 6 -22 0 Yeung AT, Tsou PM: Posterolateral ... JF: A comparison of surgeons assessment to patient's self analysis (short form 36) after far lateral lumbar disc surgery An outcome study Spine 1997, 22 :24 22- 8 Daltroy LH, Cats-Baril WL, Katz ... mm cannula: Analysis of operative failures and complications J Bone Joint Surg Am 1991, 73: 822 -31 Maroon JC, Kopituk TA, Schulhof LA, Abla A, Wilberger JE: Diagnosis and microsurgical approach...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo hóa học: " The product of the Herpes simplex virus 1 UL7 gene interacts with a mitochondrial protein, adenine nucleotide translocator 2" pot
... KS+ (Stratagene) 5'-AGGGCGGGGGCATCGGGCACCGGGATGGCCGCCGCGACGGCCGACGATG AGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCGACAGCAAGCGAACCGGAAT-3' GAAGTTCCTATACTTTCTAGAGAATAGGAACTTCCGGAAATGTTGAATACTCA TACTCTTCCTTTTTC-3' ... (5'-cttgctggacgcagagcacta-3') and UL8-r (5'gatttcgcgcaggtgatgag-3') for UL8; and 18S rRNA-f (5'-actcaacacgggaaacctca-3') and 18S rRNA-r (5'-aaccagacaaatcgctccac-3') for 18S rRNA Reactions were performed using SYBER ... (kDa) pM EF7 AM cDN p EF 100 55 UL7 38 ANT2 D MTDAAVSFAKDFLAGGVAAAISKTAVAPIER VKLLLQVQHASKQITADKQYKGIIDCVVRIPK EQGVLSFWRGNLANVIRYFPTQALNFAFKDK YKQIFLGGVDKRTQFWRYFAGNLASGGAAG ATSLCFVYPLDFARTRLAADVGKAGAEREFR...
Ngày tải lên: 20/06/2014, 01:20
báo cáo hóa học:" Neopterin production and tryptophan degradation during 24-months therapy with interferon beta-1a in multiple sclerosis patients" pot
... http://www.translational-medicine.com/content/9/1/ 42 Statistical analysis Data were expressed as means, except for gender that was expressed as percentage (%) and EDSS for which median and standard error (SE) were used An Analysis of Variance ... titer in 20 μl of a pool of 20 sera before and after adding anti human IFN-beta antibody reference (G038501-5 72, National Institute of Health, Bethesda, USA) at high and low concentrations The ... IFN-beta mediated suppression of MMPs Brain 20 04, 127 :25 9 -26 8 Gilli F, Marnetto F, Caldano M, Sala A, Malucchi S, Capobianco M, Bertolotto A: Biological markers of interferon-beta therapy: comparison...
Ngày tải lên: 20/06/2014, 03:20
báo cáo hóa học:" Establishment of an animal model of a pasteurized bone graft, with a preliminary analysis of muscle coverage or FGF-2 administration to the graft" potx
... Journal of Orthopaedic Surgery and Research 20 09, 4:31 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Ahmed AR, Manabe J, Kawaguchi N, Matsumoto S, Matsushita Y: Radiographic analysis of pasteurized ... Tartrate-resistant acid phosphatase (TRAP) staining After radiographical examination, the femurs with the graft were decalcified with EDTA (ethylenediaminetetraacetic acid), and cut sagittally, ... osteoclast maturation by the binding of fibroblast growth factor to heparan sulfate proteoglycan on rheumatoid synovial fibroblasts Arthritis Rheum 20 04, 50 :24 50 -24 58 Yamamoto M, Ikada Y, Tabata Y:...
Ngày tải lên: 20/06/2014, 04:20
Báo cáo sinh học: " Research Article Aλ3 λ1 , λ2 , Ω -Weighted Inequalities with Lipschitz r and BMO Norms" doc
... Ls μ -averaging e domains,” Journal of Mathematical Analysis and Applications, vol 22 7, no 1, pp 20 0 21 5, 1998 13 S Ding and C A Nolder, “Weighted Poincar´ inequalities for solutions to A- harmonic ... Mathematical Analysis and Applications, vol 25 6, no 1, pp 3 12 323 , 20 01 D Cruz-Uribe and C P´ rez, “Two-weight, weak-type norm inequalities for fractional integrals, e Calderon-Zygmund operators ... norm inequalities for maximal operators and ı fractional integrals on non-homogeneous spaces,” Indiana University Mathematics Journal, vol 50, no 3, pp 124 1– 128 0, 20 01 T Iwaniec and A Lutoborski,...
Ngày tải lên: 21/06/2014, 17:20
Monkey with a PinWhy you may be missing 6% a year on your investment returns pot
... might also be partly related to average better performance of smaller than larger stocks in some way http://www.fool.co.uk/Investing/guides/Can-You-Beat-The-Market.aspx (accessed 24 /01 /20 12) As ... they trade on average Barber et al quote that, between 20 00 and 20 03, the average turnover on the New York stock market was 97% – ie, traders on average hold each share they buy for about a year.7 ... the last 1 12 years5 shows that equities have returned nearly 5% a year above that of the rate of inflation In contrast, holding cash has beaten inflation by only around 1% Take care with that word...
Ngày tải lên: 27/06/2014, 23:20
Chapter 052. Approach to the Patient with a Skin Disorder (Part 2) potx
... hair-bearing areas may be characterized by destruction of hair follicles Table 52- 3 Common Dermatologic Terms Alopecia: Hair loss; it may be partial or complete Annular: Ring-shaped lesions Cyst: A soft, ... epidermal atrophy) Scar: A change in the skin secondary to trauma or inflammation Sites may be erythematous, hypopigmented, or hyperpigmented depending on their age or character Sites on hair-bearing ... associated with xerosis and aged skin Systemic conditions that can be associated with pruritus include chronic renal disease, cholestasis, pregnancy, malignancy, thyroid disease, polycythemia vera, and...
Ngày tải lên: 06/07/2014, 20:20
Báo cáo toán học: "Asymptotics of the average height of 2–watermelons with a wall" pps
... ψ − 2 − + O n−m , 24 − 2a 3 a n ( 2a) ! π n √ g(n, 2a, 0) = + πn 4ca,0 − log(n)− ψ a + − 2 +O n−m , a! √ ca,b ( 2a + 2b)! 2 2a 2b−3 na+b ( 2a) !(2b)! π n g(n, 2a, 2b) = + πn + O n−m (27 ) a! b! (a + ... = (−1) a k=0 ( 2a) 2k 4k k! da−k f dy a k y y k− 2a to obtain a+ b a (u) ϑb (u) = (−1) ( 2a) !(2b)! u a b−1 + ¯ ϑ 4a+ b a! b! a b ¯ ( 2a) 2k (2b)2j ¯ a k ϑb−j (−1 )a+ b 4k+j k!j! u u j=0 k=0 − [a = k ∧ ... ta−k− a k (t) ϑ(t) − [a = k] dt for a > 0, ( 2a) ! (2b)! 4a+ b−1 (a + b)! 2 a+ b + (−1 )a+ b ( 2a + 2b)! a! b! a b + k=0 j=0 ∞ × ∞ ∞ ¯ ¯ ta+b− a (t) ϑb (t) dt ( 2a) 2k (2b)2j 4k+j k!j! ¯ ¯ a k (t)...
Ngày tải lên: 07/08/2014, 15:23
Working with a study budy 2 pps
... had a hard day I wish you could take the day off tomorrow; you’ll look into arranging for that soon, if you can In the meantime, is there some way you can treat yourself, maybe take a short walk ... associate names with meanings, and Tameka needs to come up with an answer before looking at the choices STUDYING FOR A TEST The best way to study for a test is to test yourself, or have your study ... a different situation.’ I it every time!” Tim has a problem coming up with the right names, and Tameka has a problem when answer choices are very similar What Tim needs to is learn to associate...
Ngày tải lên: 07/08/2014, 22:20
Báo cáo toán học: "The nonexistence of regular near octagons with parameters (s, t, t2, t3) = (2, 24, 0, 8)" pdf
... spaces Ph.D thesis, Kansas State University (Manhattan, Kansas, USA), 1979 [16] P Terwilliger and C-w Weng An inequality for regular near polygons European J Combin 26 (20 05), 22 7 23 5 [17] J A ... European J Combin 20 (1999), 789–796 [9] A Hiraki and J Koolen A Higman-Haemers inequality for thick regular near polygons J Algebraic Combin 20 (20 04), 21 3 21 8 [10] A Hiraki and J Koolen A note ... last claim follows from Lemmas 2. 2, 2. 6 (2) and 2. 7 Since Dx has as many points as blocks, namely 25 , it is a symmetric 2- (25 , 9, 3)-design This implies that also the point-line dual of Dx is a...
Ngày tải lên: 08/08/2014, 12:23
Báo cáo khoa học: " Pre-segmented 2-Step IMRT with subsequent direct machine parameter optimisation – a planning study" ppsx
... parameters for the breast case C2 Detailed comparison of lung-sparing variants "b" and "c" for 2S-DMPO-50 and DMPO50 Objectives and data of study C2 from Fogliata et al [22 ] (detailed information ... of 22 situations (50 steps) and 12 of 22 (25 steps) the 2S-DMPO-plan was superior to the DMPO, taken the COV as a measure of quality as to be discussed later It can be stated that 2SDMPO plans ... of the breast cases (C2) was supplied by the group of Fogliata and Cozzi (case #3) [22 ] to be able to compare with international standards All clinical cases were primarily planned and optimised...
Ngày tải lên: 09/08/2014, 09:22
Báo cáo khoa học: " Prospective phase II study of preoperative short-course radiotherapy for rectal cancer with twice daily fractions of 2.9 Gy to a total dose of 29 Gy - Long-term results" ppt
... of data and data analysis, statistical analysis, writing and drafting of the manuscript JW: conception and design of the study, acquisition of data and data analysis AT: acquisition of data and ... Hospital Würzburg (n = 95) or an affiliated academic teaching hospital (n = 22 ) Adjuvant chemotherapy was planned for patients with pathological stage UICC ≥ II 5-Fluorouracil (5-FU) ( 425 mg/m2) as ... survival [1] Significant progress has been made in surgical, radiation and medical therapy: total mesorectal excision (TME) has become a surgical standard [2] and neoadjuvant radiotherapy (±...
Ngày tải lên: 09/08/2014, 10:20